DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and T16G1.6

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:454 Identity:90/454 - (19%)
Similarity:161/454 - (35%) Gaps:165/454 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTK----------------VLPEF--- 114
            |.:|.||..:.:|.:.||.|.:.:.       |:.:|..||                |.||:   
 Worm    11 NGEGLFQTHVYVKDVQEAIGEQMNT-------ESRLGENTKYTVVGDGNGFMSRVVLVEPEWTIT 68

  Fly   115 -----ERILRQVGDDTQLYVNCIYHSL-EPHQVL---------IFEDLA------EMGYIVLRDR 158
                 ::.:.::  .:.|:|:.|...: |.:|.:         :||:.|      |:.:.||.::
 Worm    69 ENHLPKKFILKI--CSSLHVHGIVDKMKESNQSINENEEELWAMFENEAQHLHNREVNFYVLAEK 131

  Fly   159 ----------------------------------DATLDEIRRIYFKL------------AKWHA 177
                                              |.|   ||.:|..|            |:..|
 Worm   132 WNKPEELLNAKIFFSKKFDSENKLKGFLGMEYVDDVT---IRHLYCNLKPYELHPVLKAVAQLQA 193

  Fly   178 VSLKVQNEQPEFLESYTHGLFEMPHVLNDPFMRTGME-FFVELLGKEPELNKYKP------YFES 235
            .||.:.:|:.:.:..     |:...::...|...|:: .:.:.....||..|.|.      ..|.
 Worm   194 ESLHLSDEELQSISG-----FDFKQMMGTMFNDDGLKGNYKQTRDINPERLKEKTDIVEAFGMEV 253

  Fly   236 IKDDF---LERLVEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLF 297
            :..:|   |.::|...||           ||.||||...||::...|. ......::|:||.::.
 Worm   254 VNFEFAGNLNKVVGIHKD-----------VLVHGDLWAANILWNENDG-KFSASKVIDYQIIHMG 306

  Fly   298 PLTFDLLYSIYMLLEPEHRWNNWDDLI----NYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHK 358
            ....||:......|....|..:|:.|:    .|::..|:|  .:|.|            .|.|.|
 Worm   307 NPAEDLVRVFLCTLSGADRQAHWEKLLEQFYEYFLEALED--NEIPY------------TLDQLK 357

  Fly   359 -YYEFFLIS---TFLPLMWALRDKSVDFGDLLQNEEKRRKCSFSKG--YIKEV-TILLARLDQL 415
             .|..:.::   ..|||          :|.:.|.     |.|:||.  :::|. .||..:.::|
 Worm   358 ESYRLYFVTGSLVMLPL----------YGPIAQT-----KLSYSKDTEHVEEYREILTEKAEKL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 72/370 (19%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 90/454 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.