DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and H37A05.2

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:224 Identity:56/224 - (25%)
Similarity:85/224 - (37%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 EFFVELLGKEPELNKYKPYFESIKDDFL------------ERLVEEWKDI-----RKSQKKDEYW 261
            |.::|      |..||  :|:....|.:            |..|||..||     ..|:.:..|.
 Worm   203 EIYIE------EAVKY--FFDDQSPDNMRKNLIMILGVAYEEKVEEAMDIFDLYCGSSEIQKNYS 259

  Fly   262 ----------VLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDL-LYSIYMLLEPEH 315
                      ||.|.|:...|::|.......||...|:|||.::|.....|: ..::..|.:.:.
 Worm   260 RVSAFLGHSPVLMHSDIWPSNLLFSLSSENKLEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDR 324

  Fly   316 RWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEF-FLISTFLPLMWALRDKS 379
            |....:.|..||.|.:         |.:....|..:.|......||. |..|..|.|.:.| ..|
 Worm   325 RTVQSEILDRYYKSFV---------KSLKTPNSIPYTREQLEDSYELCFPASVILMLPFIL-SFS 379

  Fly   380 VDFGDLLQNEEKRRKCSFSKGYIKE-VTI 407
            |..|:.: |||...|.:   |.|:: ||:
 Worm   380 VKLGENI-NEESVEKMA---GLIEDLVTV 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 35/153 (23%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 56/224 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.