DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and T16G1.5

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506235.1 Gene:T16G1.5 / 179775 WormBaseID:WBGene00011799 Length:434 Species:Caenorhabditis elegans


Alignment Length:344 Identity:72/344 - (20%)
Similarity:115/344 - (33%) Gaps:125/344 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DDT---QLYVNCIYHSLEPHQVLIFEDLA--EMGYIVLRDRDATLDEIRRIY---FKLAKWHAVS 179
            ||.   .||.|...|.|.|    |.:.||  :.|.:.|     |.|||..|.   ||......:|
 Worm   167 DDAVVRHLYCNAKPHELHP----ILQSLATLQAGSLHL-----TEDEINSISGYDFKSMVGRMMS 222

  Fly   180 LKVQNEQPEFLESYTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERL 244
                  :....:.||......|..|..|      ...||.||.:            |.:..:...
 Worm   223 ------EEGMKQMYTRARQINPERLTKP------TDAVEALGMD------------IVNFEISCH 263

  Fly   245 VEEWKDIRKSQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCM---LLDFQISNLFPLTFDLLYS 306
            |.::..|:|:       ||.||||...||::|..|    .:|:   ::|:|:.            
 Worm   264 VNKYAGIQKN-------VLVHGDLWAANILWKEND----GNCVASKVIDYQLI------------ 305

  Fly   307 IYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLIST---- 367
                    |..|..:||:..::|.|...           .:...|::|.: ::||:||.:.    
 Worm   306 --------HMGNPAEDLVRVFLSTLSGA-----------DRQAHWEKLLE-QFYEYFLEALEGNE 350

  Fly   368 ----------------------FLPLMWALRDKSVDFGDLLQNEEKRRKCSFSKG---------- 400
                                  .:||...:....:.:....:|.|:.|:....|.          
 Worm   351 APYTLDQLKESYRLYFVGGGLFVMPLFGPVAQAKLSYSTDNENVEEYREVLTEKAERLMEDLKRW 415

  Fly   401 --YIKEVTILLARLDQLGL 417
              |.|:||..|...::|.|
 Worm   416 HLYSKDVTKDLETAEKLTL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 53/227 (23%)
T16G1.5NP_506235.1 DUF1679 8..420 CDD:369592 66/328 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.