DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and T16G1.7

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_506233.1 Gene:T16G1.7 / 179774 WormBaseID:WBGene00011801 Length:436 Species:Caenorhabditis elegans


Alignment Length:440 Identity:85/440 - (19%)
Similarity:149/440 - (33%) Gaps:167/440 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MFRARVKYT---NRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTK------------ 109
            |..|..|.|   |..|.||..:.:..:       :|::|.....|..:|..||            
 Worm     1 MTEAEKKSTILDNGDGLFQTHVQLDDV-------QDVIGEQMNTEARLGKNTKYTVVGDGNGFMS 58

  Fly   110 ----VLPEF--------ERILRQVGDDTQLYVNCIY-HSL--------------EPHQVL--IFE 145
                |.||:        |:.:.::       .:|:: |.|              |....|  |||
 Worm    59 RVILVEPEWTVPDEHLPEKFILKI-------TSCLHVHGLVEKMKGKSPGAFPAEQEAALWAIFE 116

  Fly   146 DLAEMGYIVLRDRDATLDEIRRIYFKLAKWH----AVSLKVQNEQPEFLESYTHGLFEM------ 200
            :.|:.    |.:|:..|.:|..      ||:    .:|.|:...:....|:.|.|:..|      
 Worm   117 NEAQQ----LHNREVNLYKITE------KWNKNETMLSPKIYFYKKFDAENKTKGILGMEFVSDV 171

  Fly   201 ----------PHVLNDPFMR--------------------TGMEFFVELLGKEPELNKYKPYFES 235
                      |:.|: |.:|                    :|.: |.:::|........|..:|.
 Worm   172 TIRHLYCNAKPYELH-PVLRSLATLQAGSLHLTEDEINSISGFD-FKQMMGAMMNEEGMKNIYEQ 234

  Fly   236 IKDDFLERLVEEWKDIRK----------SQKKDEYW-----VLCHGDLHLRNIMFKHKDTVSLED 285
            .::...|||.|:...:..          |...::|.     ||.||||...||::|.::......
 Worm   235 TREINPERLTEKTNTVEAFGLEVVNFELSCNLNKYVGIERDVLVHGDLWAANILWKEENDGKFSV 299

  Fly   286 CMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVLKKIGYKGVMPSQSGL 350
            ..::|:|:.                    |..|..:||:..::|.|...           .:...
 Worm   300 SKVIDYQLI--------------------HMGNPAEDLVRVFLSTLSGA-----------DRQAH 333

  Fly   351 WKRLHQHKYYEFFLISTFLPLMWALRDKSVDFGDLLQNEEKRRKCSFSKG 400
            |:||.: ::||:||        .||.|....:.  |:..::..:|.|..|
 Worm   334 WERLLE-QFYEYFL--------EALGDDKPPYS--LEQLKESYRCYFVSG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 71/378 (19%)
T16G1.7NP_506233.1 DUF1679 10..423 CDD:369592 81/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.