DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and F58B4.5

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_505788.1 Gene:F58B4.5 / 179513 WormBaseID:WBGene00010238 Length:423 Species:Caenorhabditis elegans


Alignment Length:371 Identity:77/371 - (20%)
Similarity:133/371 - (35%) Gaps:106/371 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FNDDE----------------LVPPEWLNSEFMARVLEGNEL--EAAVKV------IDLTFSPAS 50
            |.||:                ||.|:|:.:.      |..||  :..||:      |::|.....
 Worm    34 FGDDKTATNISDMKGFMSKIALVEPKWVGAS------ENEELPEKFVVKISSQLPFIEMTKLMDF 92

  Fly    51 AKGDHY---ASIMFRARVK--YTNRKGEFQKSLIIKTMPEAEGHKKDMLGGSPIFETEMGLYTKV 110
            :.||.:   |.:.....|.  ..||:....|.|:.:..|:....|   :..|..|:.|..|...:
 Worm    93 SSGDEFWDDAKLKGMGEVTRLLHNREVATYKILMREKHPKIPFTK---VYASKPFDDENKLKAYL 154

  Fly   111 LPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFEDLAEMGYIVLRDRDATLDEIRRIYFKLAKW 175
            :.|:             |.|  .|.:..|:.:..|||..                  :...:|.:
 Worm   155 ISEY-------------YPN--IHHIGMHESIPAEDLIP------------------VIHAIAAF 186

  Fly   176 HAVSLKVQNEQ------PEFLESYTHGLF------EMPHVLNDPFMRTGMEFFVELLGKEPELNK 228
            .|:.:|:..|:      .:||: ...|.|      |..:||      ....|..|.|.|..|:.|
 Worm   187 SAIGMKLSEEETKYARGADFLD-IVFGQFMDEKSIERMNVL------LKASFPEEYLEKVEEMLK 244

  Fly   229 -YKPYFESIKDDFLERLVEEWKDIRK--SQKKDEYWVLCHGDLHLRNIM-FKHKDTVSLEDCMLL 289
             ||.|:      |..::::.:|:..:  ..|.    ||.|.||...|.: .:..:.|:|:  .::
 Worm   245 IYKDYY------FQPQMIKNFKNTCQFFGYKP----VLTHSDLWSSNFLCTRDGEKVTLK--AII 297

  Fly   290 DFQISNLFPLTFDLLYSIYMLLEPEHRWNNWDDLINYYISVLQDVL 335
            |||..::.....|:.......|..:.|....|.|:..|.:...:.|
 Worm   298 DFQTVSITTPAQDVGRLFASCLSTKDRREKADFLLEEYYNTFVNEL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 63/305 (21%)
F58B4.5NP_505788.1 DUF1679 3..414 CDD:369592 77/371 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.