DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31436 and D1044.1

DIOPT Version :9

Sequence 1:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:355 Identity:64/355 - (18%)
Similarity:134/355 - (37%) Gaps:99/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SEFMARVLEG--NELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGEFQKSLIIKTMPE 85
            :|.:.:::|.  :.::...|..::|..|..                  |.:..:.:...|...|.
 Worm     5 AEVVPKIIEAIFSSVQEPFKTFNITIKPLE------------------NSRSFWSECYQILVTPN 51

  Fly    86 AEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFEDLA-- 148
            :|.|...::  ||||..        :|....|......|.......|..:|...:|..:.|.:  
 Worm    52 SEAHADKVV--SPIFVK--------IPRISAINAACDPDNADENMEILRTLTAQEVTFYSDFSGI 106

  Fly   149 -------------------EMGYIVLRDRDATL-----------DEIRRIYFKLAKWHAVSLKVQ 183
                               :|..:...|....:           .::.::...||.:||..:::.
 Worm   107 QFSGFPIPRSYYGENLGNEKMAGLACEDYSGKVYSIDFVPGFDESQVLQLLEALAHFHAKIIEIS 171

  Fly   184 NEQPEFLESYTHGLFEMPHVL---NDPFMRTGMEFF----VELLGKEPELNKYKPYFESIKDDFL 241
            :|.|  .::|.:.|::..::.   ||.     ::|.    .||.|:          .:.:|..|.
 Worm   172 DEIP--WKNYENVLYDAAYIRMLHNDT-----LDFEKLCPAELSGR----------IQEVKHAFD 219

  Fly   242 ERLVEEWKDIRKSQKKDEY----WVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFD 302
            |      ..:|.|:||:|.    .|:||.||:..|::: :.:|..::  ..:|||..:..|::||
 Worm   220 E------DGVRNSEKKNEKLGMPLVICHNDLNASNVLW-NNETGKIQ--AFIDFQHVSKGPVSFD 275

  Fly   303 LLYSIYMLLEPEHRWNNWDDLINYYISVLQ 332
            ::..:.:.|..|:|..|....:|:|.:..:
 Worm   276 IIRILCLGLSVENRRANTQRYLNHYYTTFK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 59/324 (18%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 42/202 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I7662
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4083
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.