DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT1G55270

DIOPT Version :10

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_564684.1 Gene:AT1G55270 / 841972 AraportID:AT1G55270 Length:434 Species:Arabidopsis thaliana


Alignment Length:198 Identity:64/198 - (32%)
Similarity:89/198 - (44%) Gaps:41/198 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 VGGHDGWSYLNTVER-----W---DPIARTWSYVAPMSSMRSTA---GVAVLGG-RLYAVGGRD- 472
            :|..:.|.|:...:|     |   |||::.|..:.|:....|.|   |.|||.| .||..||:| 
plant   125 LGMSEEWVYVFKRDRDGKISWNTFDPISQLWQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDP 189

  Fly   473 --GSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRT-ETVE 534
              ||:  |.:..|:..||||.....|.|:|...|..|.|..||..|| :|..    :.|| .:.|
plant   190 LRGSM--RRVIFYNARTNKWHRAPDMLRKRHFFGCCVINNCLYVAGG-ECEG----IQRTLRSAE 247

  Fly   535 RYDPATDTWTLICSLALGRDAIGCALLGDRLIVVGGYD--------GNHALKSVEEYDPVRNGWN 591
            .|||..:.|:.|..::...    ..|:|    ||  ||        |:|.|...|.|||..|.|:
plant   248 VYDPNKNRWSFIADMSTAM----VPLIG----VV--YDKKWFLKGLGSHQLVMSEAYDPEVNSWS 302

  Fly   592 ELA 594
            .::
plant   303 PVS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 PHA03098 71..591 CDD:222983 63/193 (33%)
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..449 CDD:276965 9/35 (26%)
KELCH repeat 453..497 CDD:276965 20/50 (40%)
KELCH repeat 500..549 CDD:276965 17/49 (35%)
KELCH repeat 553..596 CDD:276965 15/50 (30%)
AT1G55270NP_564684.1 F-box_AtAFR-like 78..122 CDD:438923
NanM 155..>324 CDD:442289 56/168 (33%)
KELCH repeat 170..213 CDD:276965 18/44 (41%)
KELCH repeat 217..263 CDD:276965 17/50 (34%)
KELCH repeat 266..306 CDD:276965 15/50 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.