| Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001331512.1 | Gene: | AT5G60570 / 836178 | AraportID: | AT5G60570 | Length: | 393 | Species: | Arabidopsis thaliana |
| Alignment Length: | 251 | Identity: | 62/251 - (24%) |
|---|---|---|---|
| Similarity: | 91/251 - (36%) | Gaps: | 44/251 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 369 DKLILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVLEGPLYAVGGHD-GWSYLNT 432
Fly 433 VERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDG-SVCHRSIECYDPHTNKWSLLAPM 496
Fly 497 --NRRRGGVG---VTVANGFLYALGGHDCPASNPMVCRTETVERYDPATDTWTLICSLALGR--- 553
Fly 554 -----DAIGCAL--LGDRLIVVGGYDGNHALKSVEEYDPVRNGWNELAPMAFARAG 602 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
| PHA03098 | 71..591 | CDD:222983 | 58/238 (24%) | ||
| BACK | 179..281 | CDD:285009 | |||
| Kelch | 323..369 | CDD:128874 | 62/251 (25%) | ||
| KELCH repeat | 359..402 | CDD:276965 | 7/32 (22%) | ||
| Kelch | 370..416 | CDD:128874 | 10/45 (22%) | ||
| KELCH repeat | 406..449 | CDD:276965 | 10/43 (23%) | ||
| Kelch | 418..463 | CDD:128874 | 10/45 (22%) | ||
| KELCH repeat | 453..497 | CDD:276965 | 12/46 (26%) | ||
| Kelch | 464..510 | CDD:128874 | 14/51 (27%) | ||
| Kelch_1 | 499..546 | CDD:279660 | 11/49 (22%) | ||
| KELCH repeat | 500..549 | CDD:276965 | 11/51 (22%) | ||
| KELCH repeat | 553..596 | CDD:276965 | 13/52 (25%) | ||
| Kelch | 564..610 | CDD:128874 | 11/39 (28%) | ||
| AT5G60570 | NP_001331512.1 | F-box | 50..93 | CDD:366220 | |
| PHA03098 | <120..325 | CDD:222983 | 47/197 (24%) | ||
| KELCH repeat | 180..225 | CDD:276965 | 10/44 (23%) | ||
| KELCH repeat | 228..272 | CDD:276965 | 11/43 (26%) | ||
| KELCH repeat | 278..320 | CDD:276965 | 13/57 (23%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I2576 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.960 | |||||