DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT5G51250

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_199938.1 Gene:AT5G51250 / 835199 AraportID:AT5G51250 Length:368 Species:Arabidopsis thaliana


Alignment Length:235 Identity:47/235 - (20%)
Similarity:82/235 - (34%) Gaps:61/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 WHLMPERRSRIATERTTPRKSTVGRLLA------------------------VGG---MDAHKGA 336
            |..:..:.....|..|:.:|.:.|.:||                        :||   :.....:
plant    68 WFTLCRKPDGTLTNDTSKKKKSNGYVLATVPIPHSPPANFSSLVAVGSDIYNIGGSIYLGPSSSS 132

  Fly   337 ISIESYCPRLDKWT-PWKHMTGRRLQF---GAAVMEDKLILVGG-RDGLKTLNTVESL----DLN 392
            :||      ||..: .|:.....|::.   .|:|::.|:.:.|. :||....|:.::|    |..
plant   133 VSI------LDSQSHMWREAPSLRVELMSHSASVLDRKIYVAGSYKDGNGDSNSCKNLFEVFDTK 191

  Fly   393 TMAWAPLNAMATPRHGL---GVAVLEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRS 454
            |..|.|.....:...|:   ..|.::|..:....| |..|.....|||....|      |..||:
plant   192 TQVWHPEPIPCSKTKGIFYSKSACIDGKFHVETTH-GVVYAYKEGRWDKAIPT------MFGMRA 249

  Fly   455 TAGVAVLGGRLYAVGGRDGSVCHRSI-ECYDPHTNKWSLL 493
            :.....:...|:.:        ||.: ..||.....|.:|
plant   250 SYSFCEINNVLFYI--------HRGVFRWYDTKLRMWRIL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 47/235 (20%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874 12/76 (16%)
KELCH repeat 359..402 CDD:276965 13/50 (26%)
Kelch 370..416 CDD:128874 12/53 (23%)
KELCH repeat 406..449 CDD:276965 10/45 (22%)
Kelch 418..463 CDD:128874 10/44 (23%)
KELCH repeat 453..497 CDD:276965 8/42 (19%)
Kelch 464..510 CDD:128874 7/31 (23%)
Kelch_1 499..546 CDD:279660
KELCH repeat 500..549 CDD:276965
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
AT5G51250NP_199938.1 F-box 1..46 CDD:279040
KELCH repeat 109..149 CDD:276965 7/45 (16%)
Kelch_2 153..201 CDD:284956 12/47 (26%)
KELCH repeat 153..199 CDD:276965 12/45 (27%)
KELCH repeat 202..244 CDD:276965 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.