DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT5G03000

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_195920.1 Gene:AT5G03000 / 831712 AraportID:AT5G03000 Length:354 Species:Arabidopsis thaliana


Alignment Length:149 Identity:38/149 - (25%)
Similarity:64/149 - (42%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 PWKHMTGRR-LQFGAAVMEDKLILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVL 414
            |::|.|... :..|:     ::.::||....|....|..||..:.....|..||.||......|:
plant   128 PYQHPTSSTFVSIGS-----EIYIIGGFVKRKRSRRVLVLDCRSHQCRRLPNMALPRVSAAADVI 187

  Fly   415 EGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAP----MSSMRST-AGVAVLGGRLYAVGGR--- 471
            :|.:|.|||....:..|..|.:||..:||..:.|    :::.:|. .|..|:||::|.:.|.   
plant   188 DGKIYVVGGSKSKNIDNWGEVFDPETQTWEPIFPTTVDLTTQKSVFPGKLVMGGKVYDMDGLKVN 252

  Fly   472 ----------DGSVCHRSI 480
                      |..:|..|:
plant   253 LNLNSCVVEIDNMMCQISV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 38/149 (26%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874 4/18 (22%)
KELCH repeat 359..402 CDD:276965 8/43 (19%)
Kelch 370..416 CDD:128874 12/45 (27%)
KELCH repeat 406..449 CDD:276965 14/46 (30%)
Kelch 418..463 CDD:128874 14/49 (29%)
KELCH repeat 453..497 CDD:276965 10/42 (24%)
Kelch 464..510 CDD:128874 5/30 (17%)
Kelch_1 499..546 CDD:279660
KELCH repeat 500..549 CDD:276965
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
AT5G03000NP_195920.1 F-box 40..85 CDD:279040
KELCH repeat 138..175 CDD:276965 8/41 (20%)
Kelch 144..189 CDD:128874 12/44 (27%)
Kelch_1 178..219 CDD:279660 14/40 (35%)
KELCH repeat 179..227 CDD:276965 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.