DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT5G01660

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001331423.1 Gene:AT5G01660 / 830423 AraportID:AT5G01660 Length:656 Species:Arabidopsis thaliana


Alignment Length:233 Identity:74/233 - (31%)
Similarity:115/233 - (49%) Gaps:6/233 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 GRLLAVGGMDAHKG-AISIESYCPRLDKWTPWKHMTGRRLQFGAAVMEDKLILVGGRDGLKTLNT 385
            |::...||.|..:| ..|.||:.....:|:....:..|:...|.|.::.|:..:||.:|:.:.:.
plant   420 GKIYVFGGDDGGRGWTNSAESFNQTDGQWSLCPPLNERKGSLGGATLDGKIFAIGGGNGMVSFSD 484

  Fly   386 VESLDLNTMAWAPLNAMATPRHGLGVAVLEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMS 450
            ||.||.:...|....:|...|..:.....:..:|||||:||..||||.||:||...:|..:|.|.
plant   485 VEMLDPDIGRWIRTRSMGQERFAVASVEHKSSIYAVGGYDGKEYLNTAERFDPREHSWMNIASMK 549

  Fly   451 SMRSTAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYAL 515
            |.|....:.||..:|||:||.||.....|:|.|:|.|..|....||...||...|.|....:|.:
plant   550 SRRGCHSLVVLNEKLYAIGGFDGETMVSSVEIYEPRTGTWMTGEPMKDLRGYSAVAVVKDSIYVI 614

  Fly   516 GGHDCPASNPMVCRTETVERYDPATDTWTLICSLALGR 553
            ||:.....:.:    :|||.:... :.|..:.|.::||
plant   615 GGYKGEEDDIL----DTVECFKEG-EGWKNVPSSSIGR 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 74/233 (32%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874 11/46 (24%)
KELCH repeat 359..402 CDD:276965 11/42 (26%)
Kelch 370..416 CDD:128874 11/45 (24%)
KELCH repeat 406..449 CDD:276965 18/42 (43%)
Kelch 418..463 CDD:128874 22/44 (50%)
KELCH repeat 453..497 CDD:276965 17/43 (40%)
Kelch 464..510 CDD:128874 19/45 (42%)
Kelch_1 499..546 CDD:279660 11/46 (24%)
KELCH repeat 500..549 CDD:276965 11/48 (23%)
KELCH repeat 553..596 CDD:276965 1/1 (100%)
Kelch 564..610 CDD:128874
AT5G01660NP_001331423.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2846
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.