| Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_195686.1 | Gene: | AT4G39760 / 830134 | AraportID: | AT4G39760 | Length: | 369 | Species: | Arabidopsis thaliana |
| Alignment Length: | 239 | Identity: | 46/239 - (19%) |
|---|---|---|---|
| Similarity: | 67/239 - (28%) | Gaps: | 85/239 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 302 MPERRSRIATERTTPRKSTVGRLLAVGGMDAHKGAISIESYCPRL---DKWTPWKHMTGRRLQFG 363
Fly 364 AAVMEDKLILVGGRDGLKTLNTVESLDLNTMA-------WAPLNAMATPRHGLGVAVLEGPL--- 418
Fly 419 ----------------------------YAVGGHDG------WSYLNTVERWDPIARTWSYVAPM 449
Fly 450 SSMRSTAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLL 493 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
| PHA03098 | 71..591 | CDD:222983 | 46/239 (19%) | ||
| BACK | 179..281 | CDD:285009 | |||
| Kelch | 323..369 | CDD:128874 | 10/48 (21%) | ||
| KELCH repeat | 359..402 | CDD:276965 | 9/49 (18%) | ||
| Kelch | 370..416 | CDD:128874 | 8/52 (15%) | ||
| KELCH repeat | 406..449 | CDD:276965 | 12/79 (15%) | ||
| Kelch | 418..463 | CDD:128874 | 15/81 (19%) | ||
| KELCH repeat | 453..497 | CDD:276965 | 11/41 (27%) | ||
| Kelch | 464..510 | CDD:128874 | 8/30 (27%) | ||
| Kelch_1 | 499..546 | CDD:279660 | |||
| KELCH repeat | 500..549 | CDD:276965 | |||
| KELCH repeat | 553..596 | CDD:276965 | |||
| Kelch | 564..610 | CDD:128874 | |||
| AT4G39760 | NP_195686.1 | F-box | 16..62 | CDD:279040 | 12/68 (18%) |
| KELCH repeat | 167..212 | CDD:276965 | 11/41 (27%) | ||
| Kelch_1 | 170..211 | CDD:279660 | 10/38 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||