DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT4G39600

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001328959.1 Gene:AT4G39600 / 830114 AraportID:AT4G39600 Length:378 Species:Arabidopsis thaliana


Alignment Length:158 Identity:37/158 - (23%)
Similarity:58/158 - (36%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 PRHGLGVAVLEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVG 469
            |.....:..:...|||:.|....:..:.|...|..:.|| ..||  |||.....:.|.|::|..|
plant   126 PLEWSSIVAVGSHLYAINGPIEDAPCSNVSFLDCRSHTW-LEAP--SMRVAHTNSQLDGKMYLAG 187

  Fly   470 GRDGSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTE--- 531
            ..:.......|:.:...|..|..: |..:|..|||  ...|.:|.            :||||   
plant   188 SSENVDSLNCIQVFSTKTQTWKPV-PFQKRIFGVG--DLEGKIYT------------ICRTECGQ 237

  Fly   532 --TVERYDPATDT--------WTLICSL 549
              |::..|...|.        |:.:|.:
plant   238 GVTIKPKDLTCDVVGFCGEKDWSSVCMI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 37/158 (23%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874
KELCH repeat 359..402 CDD:276965
Kelch 370..416 CDD:128874 1/10 (10%)
KELCH repeat 406..449 CDD:276965 9/42 (21%)
Kelch 418..463 CDD:128874 14/44 (32%)
KELCH repeat 453..497 CDD:276965 9/43 (21%)
Kelch 464..510 CDD:128874 10/45 (22%)
Kelch_1 499..546 CDD:279660 14/59 (24%)
KELCH repeat 500..549 CDD:276965 14/61 (23%)
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
AT4G39600NP_001328959.1 F-box 27..70 CDD:366220
PHA03098 <116..230 CDD:222983 28/121 (23%)
KELCH repeat 131..170 CDD:276965 10/41 (24%)
Kelch_1 170..212 CDD:366584 9/42 (21%)
KELCH repeat 171..213 CDD:276965 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.