DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT4G39560

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_195666.2 Gene:AT4G39560 / 830110 AraportID:AT4G39560 Length:266 Species:Arabidopsis thaliana


Alignment Length:176 Identity:42/176 - (23%)
Similarity:68/176 - (38%) Gaps:28/176 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KWHLM---PERRSRIATERTTPRKSTV--GRLLAVGG---------MDAHKGAISIESYCPRLDK 348
            :|..:   |:....:....:.|....|  ..|:|||.         ::.|..::||.. | |...
plant    93 RWFTLCRKPKPSGHVMAAISIPNSRPVHCSGLVAVGSDIYNIGGSIINEHSSSVSILD-C-RYHT 155

  Fly   349 WTPWKHMTGRRLQFGAAVMEDKLILVGGRDGLKTLNTVESLDLNTMAWAP-LNAMA--TPRHGLG 410
            |....:|...|....|.|::.|:.:.||.....:.|.:|..|:.|..|.| ||.:|  ..|....
plant   156 WRDAPNMLVERNSHAANVIDGKIYVAGGSRDSNSSNWMEVFDIKTQTWEPVLNPIADGCDRRIRK 220

  Fly   411 VAVLEGPLYAVGGHD-GWSYLNTVERWDPIAR--------TWSYVA 447
            .||:|..:...|... |.:|...:::|:.|..        .|..||
plant   221 SAVIEEAICLFGYKGVGVAYNPRIDKWEAIGEVNYLDLGWVWLLVA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 42/176 (24%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874 14/54 (26%)
KELCH repeat 359..402 CDD:276965 14/43 (33%)
Kelch 370..416 CDD:128874 15/48 (31%)
KELCH repeat 406..449 CDD:276965 12/51 (24%)
Kelch 418..463 CDD:128874 8/39 (21%)
KELCH repeat 453..497 CDD:276965
Kelch 464..510 CDD:128874
Kelch_1 499..546 CDD:279660
KELCH repeat 500..549 CDD:276965
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
AT4G39560NP_195666.2 F-box 27..72 CDD:279040
KELCH repeat 123..162 CDD:276965 10/40 (25%)
Kelch 131..176 CDD:128874 10/46 (22%)
KELCH repeat 166..214 CDD:276965 15/47 (32%)
Kelch_1 166..206 CDD:279660 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D709680at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.