| Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_567939.1 | Gene: | AT4G33900 / 829533 | AraportID: | AT4G33900 | Length: | 379 | Species: | Arabidopsis thaliana |
| Alignment Length: | 204 | Identity: | 43/204 - (21%) |
|---|---|---|---|
| Similarity: | 74/204 - (36%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 363 GAAVMEDKLILVGG----------RDGLKTLNTVES---LDLNTMAWAPLNAMATPRHGLGVAVL 414
Fly 415 EGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSS--MRSTAGVAVLGGRLYAVGGRDGSVCH 477
Fly 478 RSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMV--CRTETVERYDPAT 540
Fly 541 DTWTLICSL 549 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
| PHA03098 | 71..591 | CDD:222983 | 43/204 (21%) | ||
| BACK | 179..281 | CDD:285009 | |||
| Kelch | 323..369 | CDD:128874 | 2/5 (40%) | ||
| KELCH repeat | 359..402 | CDD:276965 | 11/51 (22%) | ||
| Kelch | 370..416 | CDD:128874 | 12/58 (21%) | ||
| KELCH repeat | 406..449 | CDD:276965 | 11/42 (26%) | ||
| Kelch | 418..463 | CDD:128874 | 9/46 (20%) | ||
| KELCH repeat | 453..497 | CDD:276965 | 9/43 (21%) | ||
| Kelch | 464..510 | CDD:128874 | 10/45 (22%) | ||
| Kelch_1 | 499..546 | CDD:279660 | 9/48 (19%) | ||
| KELCH repeat | 500..549 | CDD:276965 | 9/50 (18%) | ||
| KELCH repeat | 553..596 | CDD:276965 | |||
| Kelch | 564..610 | CDD:128874 | |||
| AT4G33900 | NP_567939.1 | F-box | 11..54 | CDD:395521 | |
| PHA03098 | <88..288 | CDD:222983 | 41/196 (21%) | ||
| KELCH repeat | 109..162 | CDD:276965 | 11/52 (21%) | ||
| Kelch_1 | 164..205 | CDD:396078 | 11/40 (28%) | ||
| KELCH repeat | 165..205 | CDD:276965 | 11/39 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||