DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT4G11770

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_192914.1 Gene:AT4G11770 / 826783 AraportID:AT4G11770 Length:396 Species:Arabidopsis thaliana


Alignment Length:188 Identity:48/188 - (25%)
Similarity:74/188 - (39%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LILVGGRDGLKTLNTVESLDLNTMAWAPLNAMATPRHGLGVAVLEGPLYAVGGHDGWSYLNTVER 435
            :.::||.......:.|..||..:..|....:|...|....|.||:|.:|.|.|..|..|.|.:|.
plant   152 IYMIGGYINGVLSSRVFFLDCRSHTWHEAPSMQVARKSPLVNVLDGKIYVVEGWRGSDYSNLIEI 216

  Fly   436 WDPIARTWSYV-APMSSMRS---TAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLLA-P 495
            :||..:.|.:| :|.:.||.   :.|: |...:||..|.::        ..|.|..::|..|. .
plant   217 FDPKTQKWEHVPSPSAEMRGRYISKGL-VYEEKLYLFGDKN--------VVYKPKESRWDALGFD 272

  Fly   496 MNRRRGGVGVTVANGFLYALG-GHDCPASNPMVCRTETVER---YDPATDTWTLICSL 549
            ||              |:.:. |..|...|  ||.....:|   ||.....|.::..|
plant   273 MN--------------LWLVSYGSSCVIDN--VCYMVFYKRLIWYDSEVRYWRVLKGL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 48/188 (26%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874
KELCH repeat 359..402 CDD:276965 6/30 (20%)
Kelch 370..416 CDD:128874 11/44 (25%)
KELCH repeat 406..449 CDD:276965 16/43 (37%)
Kelch 418..463 CDD:128874 16/48 (33%)
KELCH repeat 453..497 CDD:276965 10/47 (21%)
Kelch 464..510 CDD:128874 9/46 (20%)
Kelch_1 499..546 CDD:279660 10/50 (20%)
KELCH repeat 500..549 CDD:276965 10/52 (19%)
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
AT4G11770NP_192914.1 F-box 15..55 CDD:279040
KELCH repeat 141..183 CDD:276965 6/30 (20%)
Kelch 152..197 CDD:128874 11/44 (25%)
Kelch_1 186..231 CDD:279660 16/44 (36%)
KELCH repeat 187..234 CDD:276965 17/46 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.