| Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_187493.1 | Gene: | AT3G08810 / 820028 | AraportID: | AT3G08810 | Length: | 343 | Species: | Arabidopsis thaliana |
| Alignment Length: | 204 | Identity: | 46/204 - (22%) |
|---|---|---|---|
| Similarity: | 73/204 - (35%) | Gaps: | 45/204 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 431 NTVERWDPIAR----TWSYVAPMSSMRSTAGVAVLGG-------RLYAVGGRDGSVC-------- 476
Fly 477 HRSIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPATD 541
Fly 542 TWTLICSLALGRDAIGCALLGDRLIVVGGYDGNHALKSVEE-----YDPVRNGWNELAPM----A 597
Fly 598 FARAGACVV 606 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
| PHA03098 | 71..591 | CDD:222983 | 38/183 (21%) | ||
| BACK | 179..281 | CDD:285009 | |||
| Kelch | 323..369 | CDD:128874 | |||
| KELCH repeat | 359..402 | CDD:276965 | |||
| Kelch | 370..416 | CDD:128874 | |||
| KELCH repeat | 406..449 | CDD:276965 | 6/21 (29%) | ||
| Kelch | 418..463 | CDD:128874 | 10/35 (29%) | ||
| KELCH repeat | 453..497 | CDD:276965 | 12/58 (21%) | ||
| Kelch | 464..510 | CDD:128874 | 9/53 (17%) | ||
| Kelch_1 | 499..546 | CDD:279660 | 9/46 (20%) | ||
| KELCH repeat | 500..549 | CDD:276965 | 9/48 (19%) | ||
| KELCH repeat | 553..596 | CDD:276965 | 10/47 (21%) | ||
| Kelch | 564..610 | CDD:128874 | 13/52 (25%) | ||
| AT3G08810 | NP_187493.1 | F-box | 25..68 | CDD:279040 | |
| Kelch_6 | 126..169 | CDD:290672 | 8/42 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D709680at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||