DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17754 and AT2G41360

DIOPT Version :9

Sequence 1:	NP_572549.2	Gene:	CG17754 / 31873	FlyBaseID:	FBgn0030114	Length:	654	Species:	Drosophila melanogaster
Sequence 2:	NP_001318401.1	Gene:	AT2G41360 / 818734	AraportID:	AT2G41360	Length:	373	Species:	Arabidopsis thaliana

Alignment Length:	121	Identity:	25/121 - (20%)
Similarity:	41/121 - (33%)	Gaps:	38/121 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   402 MATPRHGL----GVAVLEGPLYAVGGHDGWSYLNTVERW-----------DPIARTWSYVAPMSS 451
            ::.|.|..    ....::..:|.|||..     |..|.|           .||...:..:|
plant    97 LSFPSHNFMFRASTVAVDSEIYFVGGRP-----NPTELWILDTRSGKLRQGPIKPEFLRIA---- 152

  Fly   452 MRSTAGVAVLGGRLYAVGGRDGSVCHRSIECYDPHTNKWSLLAPMNRRRGGVGVTV 507
              |::.|.|..|:::.:  :|........:.||..|..|.:          |||.|
plant   153 --SSSAVGVFDGKIHVI--QDLKQDETEEQVYDLETQTWKV----------VGVPV 194

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17754	NP_572549.2	BTB	70..170	CDD:279045
		PHA03098	71..591	CDD:222983	25/121 (21%)
		BACK	179..281	CDD:285009
		Kelch	323..369	CDD:128874
		KELCH repeat	359..402	CDD:276965	25/121 (21%)
		Kelch	370..416	CDD:128874	2/17 (12%)
		KELCH repeat	406..449	CDD:276965	11/57 (19%)
		Kelch	418..463	CDD:128874	13/55 (24%)
		KELCH repeat	453..497	CDD:276965	9/43 (21%)
		Kelch	464..510	CDD:128874	9/44 (20%)
		Kelch_1	499..546	CDD:279660	4/9 (44%)
		KELCH repeat	500..549	CDD:276965	4/8 (50%)
		KELCH repeat	553..596	CDD:276965
		Kelch	564..610	CDD:128874
AT2G41360	NP_001318401.1	F-box	9..52	CDD:395521
		KELCH repeat	106..149	CDD:276965	9/47 (19%)
		KELCH repeat	153..205	CDD:276965	13/54 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910