DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG17754 and AT2G29860

DIOPT Version :9

Sequence 1:	NP_572549.2	Gene:	CG17754 / 31873	FlyBaseID:	FBgn0030114	Length:	654	Species:	Drosophila melanogaster
Sequence 2:	NP_180547.1	Gene:	AT2G29860 / 817536	AraportID:	AT2G29860	Length:	240	Species:	Arabidopsis thaliana

Alignment Length:	116	Identity:	33/116 - (28%)
Similarity:	51/116 - (43%)	Gaps:	11/116 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   399 LNAMATPRHGLGVAVLEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGG 463
            ||::.....|..|..:...:|.:||:: :..::||...|....||.|:..|...|..|...|:.|
plant   102 LNSLPHMFPGAAVVTIGYKIYVMGGYN-YQPVSTVIIIDCRFHTWHYLQDMQRARYHATPGVIDG 165

  Fly   464 RLYAVGGR---DGSVCHRSIECYDPHTNKWSLL---APMNRRRGGVGVTVA 508
            |:|.:|||   |..    .:|.:|..|..|..:   .|......|:.||.|
plant   166 RIYVIGGRKKQDAD----WVEVFDVTTESWETVPTQCPNEASENGLFVTYA 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG17754	NP_572549.2	BTB	70..170	CDD:279045
		PHA03098	71..591	CDD:222983	33/116 (28%)
		BACK	179..281	CDD:285009
		Kelch	323..369	CDD:128874
		KELCH repeat	359..402	CDD:276965	2/2 (100%)
		Kelch	370..416	CDD:128874	4/16 (25%)
		KELCH repeat	406..449	CDD:276965	11/42 (26%)
		Kelch	418..463	CDD:128874	13/44 (30%)
		KELCH repeat	453..497	CDD:276965	15/49 (31%)
		Kelch	464..510	CDD:128874	15/51 (29%)
		Kelch_1	499..546	CDD:279660	4/10 (40%)
		KELCH repeat	500..549	CDD:276965	4/9 (44%)
		KELCH repeat	553..596	CDD:276965
		Kelch	564..610	CDD:128874
AT2G29860	NP_180547.1	F-box	22..64	CDD:279040
		Kelch_1	108..152	CDD:279660	11/44 (25%)
		KELCH repeat	111..151	CDD:276965	11/40 (28%)
		Kelch_1	154..196	CDD:279660	14/45 (31%)
		KELCH repeat	155..195	CDD:276965	14/43 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X9
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910