DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT2G29830

DIOPT Version :10

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_180544.1 Gene:AT2G29830 / 817533 AraportID:AT2G29830 Length:383 Species:Arabidopsis thaliana


Alignment Length:230 Identity:45/230 - (19%)
Similarity:75/230 - (32%) Gaps:83/230 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 GLGVAVLEGPLYAVGGHDGWSY--LNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGG 470
            |..|..::..:|.:||..|:::  .:.|...|....||.|:..|...|..|...::.||:|.:||
plant   121 GAAVVTIDYKMYVMGGCIGYNHPASSNVIVIDCRFHTWKYLPDMKRARCRAATGIIDGRIYVIGG 185

  Fly   471 RDGSVCHRS----IECYDPHTNKWSLL---APMNRRRGGVGVT--VANGFLYALGGHDCPASNPM 526
                 |.:.    :|.:|..|..|..:   .|.:....|..:|  |..|.|:.|....|.:    
plant   186 -----CKKQDADWVEVFDVTTQSWETVPSECPNDANENGEFITYVVMQGRLFILDLECCFS---- 241

  Fly   527 VCRTETVERYDPATDTW----------------------------TLICSL-------------- 549
                     |:|....|                            .|.|:|              
plant   242 ---------YEPVQGLWESWDDGSELMRFWHSSSSCVVGDLLYALDLTCALEHPIVVYYPNELVW 297

  Fly   550 --ALGRDAIGCALLGD----------RLIVVGGYD 572
              .:|.|.....:|.:          :|:::||.|
plant   298 RPVMGVDTAHLPILTEYTSTLANFDGKLVILGGGD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 PHA03098 71..591 CDD:222983 45/230 (20%)
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..449 CDD:276965 11/42 (26%)
KELCH repeat 453..497 CDD:276965 13/50 (26%)
KELCH repeat 500..549 CDD:276965 12/78 (15%)
KELCH repeat 553..596 CDD:276965 6/30 (20%)
AT2G29830NP_180544.1 F-box_AtAFR-like 29..73 CDD:438923
NanM 113..345 CDD:442289 45/230 (20%)
KELCH repeat 120..164 CDD:276965 11/42 (26%)
KELCH repeat 168..216 CDD:276965 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.