DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT2G29830

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_180544.1 Gene:AT2G29830 / 817533 AraportID:AT2G29830 Length:383 Species:Arabidopsis thaliana


Alignment Length:230 Identity:45/230 - (19%)
Similarity:75/230 - (32%) Gaps:83/230 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 GLGVAVLEGPLYAVGGHDGWSY--LNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGG 470
            |..|..::..:|.:||..|:::  .:.|...|....||.|:..|...|..|...::.||:|.:||
plant   121 GAAVVTIDYKMYVMGGCIGYNHPASSNVIVIDCRFHTWKYLPDMKRARCRAATGIIDGRIYVIGG 185

  Fly   471 RDGSVCHRS----IECYDPHTNKWSLL---APMNRRRGGVGVT--VANGFLYALGGHDCPASNPM 526
                 |.:.    :|.:|..|..|..:   .|.:....|..:|  |..|.|:.|....|.:    
plant   186 -----CKKQDADWVEVFDVTTQSWETVPSECPNDANENGEFITYVVMQGRLFILDLECCFS---- 241

  Fly   527 VCRTETVERYDPATDTW----------------------------TLICSL-------------- 549
                     |:|....|                            .|.|:|              
plant   242 ---------YEPVQGLWESWDDGSELMRFWHSSSSCVVGDLLYALDLTCALEHPIVVYYPNELVW 297

  Fly   550 --ALGRDAIGCALLGD----------RLIVVGGYD 572
              .:|.|.....:|.:          :|:::||.|
plant   298 RPVMGVDTAHLPILTEYTSTLANFDGKLVILGGGD 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 45/230 (20%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874
KELCH repeat 359..402 CDD:276965
Kelch 370..416 CDD:128874 2/7 (29%)
KELCH repeat 406..449 CDD:276965 11/42 (26%)
Kelch 418..463 CDD:128874 12/46 (26%)
KELCH repeat 453..497 CDD:276965 13/50 (26%)
Kelch 464..510 CDD:128874 13/54 (24%)
Kelch_1 499..546 CDD:279660 10/76 (13%)
KELCH repeat 500..549 CDD:276965 12/78 (15%)
KELCH repeat 553..596 CDD:276965 6/30 (20%)
Kelch 564..610 CDD:128874 4/9 (44%)
AT2G29830NP_180544.1 F-box 28..75 CDD:279040
Kelch_1 118..165 CDD:279660 11/43 (26%)
KELCH repeat 120..164 CDD:276965 11/42 (26%)
Kelch_1 167..209 CDD:279660 12/46 (26%)
KELCH repeat 168..216 CDD:276965 13/52 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.