DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AFR

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_565572.1 Gene:AFR / 816990 AraportID:AT2G24540 Length:372 Species:Arabidopsis thaliana


Alignment Length:177 Identity:49/177 - (27%)
Similarity:74/177 - (41%) Gaps:29/177 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 RW---DPIARTWSYVAPM-SSMRSTAGVAVLG-------GRLYAVGGRDGSVCHRSIECYDPHTN 488
            :|   |..:..|..:.|| :|....:....|.       |:|:.:||.|   .:||...|...||
plant    95 QWQSLDLASGRWFVLPPMPNSFTKISSPHALSCASMPRQGKLFVLGGGD---VNRSAVVYTALTN 156

  Fly   489 KWSLLAPMNRRR-----GGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPATDTWTLICS 548
            :||.::||...|     |.|     ||.:.|:||  ....|...  |..||.|||..||||::..
plant   157 RWSCISPMMSPRTYFVSGNV-----NGKIMAVGG--SVGGNGEA--TTEVESYDPDNDTWTVVKK 212

  Fly   549 LALGRDAIGCALLGDRLIVVGGYDGNHALKSV-EEYDPVRNGWNELA 594
            |.:.......|::|..:.|..|:........: :.||.....|.|::
plant   213 LPMVLAKYDSAVIGKEMCVTEGWAWPFMFPPMGQVYDSDEGTWREMS 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045
PHA03098 71..591 CDD:222983 47/172 (27%)
BACK 179..281 CDD:285009
Kelch 323..369 CDD:128874
KELCH repeat 359..402 CDD:276965
Kelch 370..416 CDD:128874
KELCH repeat 406..449 CDD:276965 3/16 (19%)
Kelch 418..463 CDD:128874 7/38 (18%)
KELCH repeat 453..497 CDD:276965 14/50 (28%)
Kelch 464..510 CDD:128874 16/50 (32%)
Kelch_1 499..546 CDD:279660 19/51 (37%)
KELCH repeat 500..549 CDD:276965 19/53 (36%)
KELCH repeat 553..596 CDD:276965 8/43 (19%)
Kelch 564..610 CDD:128874 6/32 (19%)
AFRNP_565572.1 F-box 27..72 CDD:279040
Kelch_1 167..214 CDD:279660 19/55 (35%)
KELCH repeat 168..214 CDD:276965 19/54 (35%)
KELCH repeat 217..259 CDD:276965 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.