DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and AT4G19330

DIOPT Version :10

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001319995.1 Gene:AT4G19330 / 28720147 AraportID:AT4G19330 Length:383 Species:Arabidopsis thaliana


Alignment Length:251 Identity:55/251 - (21%)
Similarity:80/251 - (31%) Gaps:95/251 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 YAVGGHDGWSYLNTVERWDPIARTWSY--------VAP-MSSMRSTAGVAVLGGRLYAVGGRDGS 474
            |.:||          :...|....|.|        .|| |...|..|...||.|:||.:||.:..
plant   149 YEIGG----------QNMTPSTDVWVYDKLIGKQRKAPSMMVARKNAFTCVLDGKLYVMGGCEAD 203

  Fly   475 VCHRSIECYDPHTNKWSLLAP------------MNRRRGGVGV-TVANGFLYA------------ 514
            ......|.:||.|..|..|..            :..::|.|.| :....|:|.            
plant   204 ESTHWAEVFDPKTQTWEALPDPGVELRYSSVKNIQTKQGKVYVRSNKKNFVYLIKECMWEVAEEN 268

  Fly   515 LGGHDCPASNPMVCRTETVER---YDPATDTWTLICSL--------------------------A 550
            ||...|...|  ||...:.:|   ||...:.|.|:..:                          |
plant   269 LGESTCEIEN--VCYCYSNKRYWWYDAKCEEWRLVKGVSGLYEYYKTDSEIGNYGGKLVVFWDRA 331

  Fly   551 LGR----DAIGCALLGDRLIVVGGYDG---NHALKSVEEYDPVRNGWNELAPMAFA 599
            :.|    ..|.||::.    :..|:||   .|    :|..|.|.     :||.::|
plant   332 VSRLTATKEIWCAMIS----LEKGHDGEIWGH----IEWLDAVL-----IAPRSYA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 PHA03098 71..591 CDD:222983 52/241 (22%)
KELCH repeat 359..402 CDD:276965
KELCH repeat 406..449 CDD:276965 8/38 (21%)
KELCH repeat 453..497 CDD:276965 15/55 (27%)
KELCH repeat 500..549 CDD:276965 16/64 (25%)
KELCH repeat 553..596 CDD:276965 12/49 (24%)
AT4G19330NP_001319995.1 F-box_AtAFR-like 34..70 CDD:438923
NanM <157..>246 CDD:442289 23/88 (26%)
KELCH repeat 182..224 CDD:276965 15/41 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.