Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506607.2 | Gene: | C53A5.11 / 183741 | WormBaseID: | WBGene00008269 | Length: | 382 | Species: | Caenorhabditis elegans |
Alignment Length: | 333 | Identity: | 75/333 - (22%) |
---|---|---|---|
Similarity: | 125/333 - (37%) | Gaps: | 75/333 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 331 DAHKGAISIESYCPR-LDKWTPWKHMTGRRLQ-----FGAAVMEDKLILVGGRDGLK-------- 381
Fly 382 ----------------TLNTVESLDL-------------------------------NTMAWAPL 399
Fly 400 NAMATPRHGLGVAVLEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGR 464
Fly 465 LYAVGGRDGSVCHRSIECYDPHT-NKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVC 528
Fly 529 RTETVERYDPATDTWTLICSLALGRDAIGCALLGDRLIVVGGYDGN-HALKSVEEYDPVRNGWNE 592
Fly 593 LAPMAFAR 600 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
PHA03098 | 71..591 | CDD:222983 | 72/322 (22%) | ||
BACK | 179..281 | CDD:285009 | |||
Kelch | 323..369 | CDD:128874 | 9/43 (21%) | ||
KELCH repeat | 359..402 | CDD:276965 | 16/102 (16%) | ||
Kelch | 370..416 | CDD:128874 | 14/100 (14%) | ||
KELCH repeat | 406..449 | CDD:276965 | 9/42 (21%) | ||
Kelch | 418..463 | CDD:128874 | 9/44 (20%) | ||
KELCH repeat | 453..497 | CDD:276965 | 13/44 (30%) | ||
Kelch | 464..510 | CDD:128874 | 16/46 (35%) | ||
Kelch_1 | 499..546 | CDD:279660 | 12/46 (26%) | ||
KELCH repeat | 500..549 | CDD:276965 | 12/48 (25%) | ||
KELCH repeat | 553..596 | CDD:276965 | 13/43 (30%) | ||
Kelch | 564..610 | CDD:128874 | 13/38 (34%) | ||
C53A5.11 | NP_506607.2 | KELCH repeat | 153..197 | CDD:276965 | 9/43 (21%) |
BTB | <165..379 | CDD:333434 | 51/185 (28%) | ||
KELCH repeat | 200..243 | CDD:276965 | 13/43 (30%) | ||
KELCH repeat | 247..290 | CDD:276965 | 12/49 (24%) | ||
KELCH repeat | 293..339 | CDD:276965 | 14/45 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4441 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.900 |