Sequence 1: | NP_572549.2 | Gene: | CG17754 / 31873 | FlyBaseID: | FBgn0030114 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017212974.2 | Gene: | LOC108178999 / 108178999 | -ID: | - | Length: | 268 | Species: | Danio rerio |
Alignment Length: | 260 | Identity: | 90/260 - (34%) |
---|---|---|---|
Similarity: | 131/260 - (50%) | Gaps: | 11/260 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 352 WKHMTGRRLQFGAAVMEDKLILVGGRDGLKTLNTVESLDLNT---MAWAPLNAMATPRHGLGVAV 413
Fly 414 LEGPLYAVGGHDGWSYLNTVERWDPIARTWSYVAPMSSMRSTAGVAVLGGRLYAVGGRDGSVCHR 478
Fly 479 SIECYDPHTNKWSLLAPMNRRRGGVGVTVANGFLYALGGHDCPASNPMVCRTETVERYDPATDTW 543
Fly 544 TLICSLALGRDAIGCALLGDRLIVVGGYDGNHALKSVEEYDPVRNGWNELAPMAFAR--AGACVV 606
Fly 607 606 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17754 | NP_572549.2 | BTB | 70..170 | CDD:279045 | |
PHA03098 | 71..591 | CDD:222983 | 82/241 (34%) | ||
BACK | 179..281 | CDD:285009 | |||
Kelch | 323..369 | CDD:128874 | 1/16 (6%) | ||
KELCH repeat | 359..402 | CDD:276965 | 12/45 (27%) | ||
Kelch | 370..416 | CDD:128874 | 14/48 (29%) | ||
KELCH repeat | 406..449 | CDD:276965 | 14/42 (33%) | ||
Kelch | 418..463 | CDD:128874 | 16/44 (36%) | ||
KELCH repeat | 453..497 | CDD:276965 | 19/43 (44%) | ||
Kelch | 464..510 | CDD:128874 | 19/45 (42%) | ||
Kelch_1 | 499..546 | CDD:279660 | 17/46 (37%) | ||
KELCH repeat | 500..549 | CDD:276965 | 17/48 (35%) | ||
KELCH repeat | 553..596 | CDD:276965 | 18/42 (43%) | ||
Kelch | 564..610 | CDD:128874 | 22/45 (49%) | ||
LOC108178999 | XP_017212974.2 | BTB | <4..205 | CDD:333434 | 65/198 (33%) |
KELCH repeat | 19..65 | CDD:276965 | 12/45 (27%) | ||
KELCH repeat | 69..112 | CDD:276965 | 14/42 (33%) | ||
KELCH repeat | 116..159 | CDD:276965 | 18/42 (43%) | ||
KELCH repeat | 163..207 | CDD:276965 | 17/49 (35%) | ||
KELCH repeat | 210..255 | CDD:276965 | 19/44 (43%) | ||
Kelch | 221..265 | CDD:128874 | 21/43 (49%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D312716at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000036 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |