DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17754 and klhl20

DIOPT Version :9

Sequence 1:NP_572549.2 Gene:CG17754 / 31873 FlyBaseID:FBgn0030114 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001135481.1 Gene:klhl20 / 100216018 XenbaseID:XB-GENE-960635 Length:234 Species:Xenopus tropicalis


Alignment Length:164 Identity:74/164 - (45%)
Similarity:102/164 - (62%) Gaps:2/164 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 HADNILKRMQLYVDSQQLCDVVLIAGIDGKRVPAHRLVLSASSAYFSAMFTGSLRETKEQEVTLG 121
            |....|:.:.|....::||||||:.|  .|::.|||::|||.|.||.|||||.|.|:::.||.:.
 Frog    50 HPRQTLEVINLLRKHRELCDVVLVVG--AKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIR 112

  Fly   122 EVHGDALHLLVQYCYTGFIEMREDTVETLLATACLLQLNAVVTACCNFLARQLHPSNCLGFAFFA 186
            ::...|:.||:.:.||..|.:.|..|:|||..||||||..:..|||.||.|||.||||||...||
 Frog   113 DIDERAMELLIDFSYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFA 177

  Fly   187 EQQSCTTLLRLAQAYTCQYFMQVCQNQEFFQLNA 220
            :..||..|||:|..:|...|.:|..:..|.:||:
 Frog   178 DTHSCRELLRIADKFTQHNFQEVRDSVLFRKLNS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17754NP_572549.2 BTB 70..170 CDD:279045 46/99 (46%)
PHA03098 71..591 CDD:222983 71/150 (47%)
BACK 179..281 CDD:285009 17/42 (40%)
Kelch 323..369 CDD:128874
KELCH repeat 359..402 CDD:276965
Kelch 370..416 CDD:128874
KELCH repeat 406..449 CDD:276965
Kelch 418..463 CDD:128874
KELCH repeat 453..497 CDD:276965
Kelch 464..510 CDD:128874
Kelch_1 499..546 CDD:279660
KELCH repeat 500..549 CDD:276965
KELCH repeat 553..596 CDD:276965
Kelch 564..610 CDD:128874
klhl20NP_001135481.1 BTB 59..162 CDD:279045 48/104 (46%)
BTB 69..165 CDD:197585 47/97 (48%)
BACK_Kelch 165..>203 CDD:269808 18/37 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312716at33208
OrthoFinder 1 1.000 - - FOG0000036
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.