DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94b and Ir87a

DIOPT Version :9

Sequence 1:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:320 Identity:73/320 - (22%)
Similarity:122/320 - (38%) Gaps:67/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 IFVLIEITFLGVTILISRQSRHQM------IPNTL--VNLCAFRAILGLPFPETRRTSLSLRQLF 362
            |||   :|...|..|..|.|..|:      .|..|  :.:...:||....||      ::|||||
  Fly   507 IFV---VTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPAQDFP------ITLRQLF 562

  Fly   363 LAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGVDFFNQ 427
            ....|.|..||......|.|.||.|....|::..:|:.::.:||:...:....:.|: |..|  :
  Fly   563 ALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKD-GEIF--K 624

  Fly   428 YMPRKVTLTFTERAKLLFSLKGNHAFTLFSESFAIIESYQRS------KGLRAHC--TSEDL--- 481
            |:..|..:.:    .|:..|  |.|..  :|..|:..|.|.|      :..|.:|  ..|.|   
  Fly   625 YIREKFQMCY----NLVDCL--NDAAQ--NEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESLYVY 681

  Fly   482 IVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWLKNIPSSLEKNLMQITIPYDRERVHPL 546
            :|...:|:.|.|.:.      :...|:.:.|||....|.:::.       |:..|..:..||...
  Fly   682 LVTMLLPKKYHLLHQ------INPVIQHIIESGHMQKWARDLD-------MRRMIHEEITRVRED 733

  Fly   547 SIEHLTW--------------LWCILILGYSISMIVFFVEMSLKRRK-KNLENRAPNICI 591
            ..:.||:              |....:..:.:..:.:......:.|| |.:..:..||.|
  Fly   734 PFKALTFDQFRGAIAFSGGLLLVASCVFAFELCYVKYVYRTEKRERKTKKITKKVHNIKI 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94bNP_732700.2 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009985
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.