DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94b and Ir7a

DIOPT Version :9

Sequence 1:NP_732700.2 Gene:Ir94b / 318728 FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:292 Identity:60/292 - (20%)
Similarity:118/292 - (40%) Gaps:44/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 IFYIILVYVIFVLIEITFLGVTILISRQ--SRH--QMIPNTLVNLCAFRAILGLPFPETRRTSLS 357
            |.::.||....:|:.:.::...::..|.  :.|  |::...:.|....|::     |.:.|    
  Fly   347 IVWLALVVSSLLLVLVLWMRNRLVCGRSDLASHALQVLTTLMGNPLEARSL-----PRSSR---- 402

  Fly   358 LRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENFIEKEIGV 422
            ||.|:....|..::..:....||......|..:|......||..|..|::...            
  Fly   403 LRILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEISELIRSNYTLINQE------------ 455

  Fly   423 DFFNQYMPRKVTLTFTERAKLLF----SLKGNHAFTLFSESFAIIESYQRSKGLRAHCT--SEDL 481
              :..|.||::|:.....:|..|    .|.....||..| ..|.:|.|.......:..|  .|.:
  Fly   456 --YLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTS-LIATMEYYNMMHWSTSRLTHIKEHI 517

  Fly   482 IVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWLKNIPSSLEKNLMQITIPYDRE-RVHP 545
            .:.:.|  || |..:|:|.....|.|:|:..:||..::::      |.:..|...|::.: .|.|
  Fly   518 FLYQMV--IY-LRRHSLLKFAFDRKIKQLLSAGIIGYFVR------EFDACQYRKPFEEDYEVTP 573

  Fly   546 LSIEHLTWLWCILILGYSISMIVFFVEMSLKR 577
            :.::....|:.|.::..|.:::.|.:|:..:|
  Fly   574 IPLDSFCGLYYISLIWLSAAVVAFILELLSQR 605



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.