DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94c and Ir68b

DIOPT Version :9

Sequence 1:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:370 Identity:70/370 - (18%)
Similarity:131/370 - (35%) Gaps:105/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 PNTACSLIVIVPCS---PKWR-FMDVLHKLGVLKLIGCLLIAYAVFVLIETLILWLTHRISGREV 334
            |.|..:|.::||.|   |::. |:.|..     :.:..||:   |.:|:..|:.|:..|:..|..
  Fly   288 PYTRRNLHLVVPASAIQPEYLIFVRVFR-----RTVWYLLL---VTLLVVVLVFWVMQRLQRRIP 344

  Fly   335 RLTSLNQLLNPRAFRGILGLPF----------------PEFRRSSISLRQLFLV-ISVFGLVYSN 382
            |             ||::....                |..|.||.|..:.||: ..:|..|.|.
  Fly   345 R-------------RGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLST 396

  Fly   383 FVSCTLSALLTKPAQNPQVRNFKELRDSGL----ITIMDKYTHSFIEKHIDPEFFDHVLPHYLIL 443
            .....|.:...:|:...||....:|....:    :|.|.....|.:.:|           .|.:|
  Fly   397 IYFAKLESGFVRPSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEH-----------QYGLL 450

  Fly   444 QKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQKSFDERVFC----ESESLTIAWNLPRMYVLGNN 504
            :.: :.::......||...:.....:....:.:.|..|.|.    :|::...|:::.|.|     
  Fly   451 ENR-SRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREY----- 509

  Fly   505 SVLKWMLSRYITYMP-----------------QTGIPDSWTEQ--------LPKVLKLLYNV--- 541
              |:.|:..||  :|                 :.|..:.|.:.        .|...:.|.::   
  Fly   510 --LRSMICTYI--LPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQ 570

  Fly   542 ------TSPRRIKEGAVPLSIQHLSWIWHLLFIGESIATLVFIVE 580
                  ::...|:...|.|::..|...::|..:|..|:.|.|.||
  Fly   571 TDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAVE 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir94cNP_732701.2 None
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 51/307 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.