DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94c and Ir56b

DIOPT Version :9

Sequence 1:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:386 Identity:87/386 - (22%)
Similarity:157/386 - (40%) Gaps:68/386 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 IPLSELKDYEIVQFAVKYNLSLK-LYDQNESKSDHFDIQLGPLFITKDFPTQMAFVSPNTACSLI 281
            :|...:.:.:|:  :.||||||. :..:.|..||.|:.      ....:|.::.     |.|.::
  Fly    63 LPKKSVVEQDII--SGKYNLSLHGVIIRPEETSDFFNA------TQHSYPLELM-----TNCVMV 114

  Fly   282 VIVPCSPKWRFMDVLHKLGVLKLI-GCLLIAYAVFVLIETLILWLTHRISGREVRLTSLNQLLNP 345
            .:.|..|||.:|  :..||  |.| .||.:......|:...:.|   |..|...|..:.| :|:.
  Fly   115 PLAPELPKWMYM--VWPLG--KYIWTCLFLGTFYVALLLRYVHW---REPGNATRSYTRN-VLHA 171

  Fly   346 RA---FRGILGLPFPEFRRSSISLRQLFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKEL 407
            .|   |...:.:.. :.:.:||.:...:.::.:||.:.:|:....::|...||.....:..:.:|
  Fly   172 MALLMFSANMNMSV-KLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDL 235

  Fly   408 RDSGL-ITIMDKYTHSFIEKHIDPEFFDHVLPHYLILQKKEALRMIWNFNDSYSYVMYTTTWKSL 471
            ..|.| |.|.|    |.:|:.       ..||.|..|        :.:.:.||:||:....|...
  Fly   236 IHSRLRIVIHD----SLLEEL-------RWLPVYQAL--------LASPSRSYAYVVTQDAWLFF 281

  Fly   472 NTVQKSFDERVFCESESLTIAWNLPRMYVLGNNSVLKWMLSRYITYMPQTGIPDSWTE------- 529
            |..||...:..|..|:  .....|.....:.:|:.....|:::|..:.|.|:.:.|.|       
  Fly   282 NRQQKVLIQPYFHLSK--VCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAE 344

  Fly   530 --QLPKVLKLLYNVTSPRRIKEGAVPLSIQHLSWIWHLLFIGESIATLVFIVEILLQKSNQ 588
              ...||....|.|.          ||:::..:..|.:|..|..|::|.|.:|:.:.:..|
  Fly   345 QAGYAKVFLDTYPVE----------PLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRRKQ 395



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.