DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94c and Ir48b

DIOPT Version :9

Sequence 1:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_610697.1 Gene:Ir48b / 36254 FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster


Alignment Length:286 Identity:59/286 - (20%)
Similarity:109/286 - (38%) Gaps:35/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 CLLIAYAVFVLIETLILWLTHRISGREVRLTSLNQLLNPRAFRGILGLPFPEFRRSSISLRQ--- 368
            ||:|...:.|...:.|.||.   ||:......|.::.:...|.|        |....|..|:   
  Fly   309 CLVIYVLLVVNFLSFIGWLR---SGKWEFSKYLLEVFSSLLFSG--------FYLKEIRGRERYI 362

  Fly   369 LFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSGLITIMDKYTHSFIEKHIDPEFF 433
            ||.|:.:.|.|||......|.::|.......|:..|:.|.:|.:..::|.|......|:..||..
  Fly   363 LFGVLFIAGFVYSTEYLGLLKSMLISEVFEKQIDTFEALVESNITLMVDPYDKILFAKYNMPEIL 427

  Fly   434 DHVLPHYLILQKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQKSFDERVFCESESLTIAWNLPRM 498
            ..::.   ::..:..|:....|:..|:|::::......:..|:...     ..:.|.|..:...:
  Fly   428 SPIME---LVSFETLLKHRNRFDQDYAYILFSDRMALYDYAQQFLK-----HPKLLRIPIDFSFL 484

  Fly   499 YVLGNNSVLKWMLSRYITYMPQTGIPDSWTEQLP--------KVLKLLYNVTSPRRIKEGAVPLS 555
            |. |.....:|.|..::............|.:|.        :|..|.:.:|.    ...|.||:
  Fly   485 YT-GIPMRKRWFLKHHLGRAWYWAFESGLTRKLALDADFEAVRVGYLSFLITE----HVEAQPLN 544

  Fly   556 IQHLSWIWHLLFIGESIATLVFIVEI 581
            :.:.......|.||..:|.|.|::|:
  Fly   545 VDYFVMPAIALAIGYILALLSFVIEM 570



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.