DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir94c and Ir7g

DIOPT Version :9

Sequence 1:NP_732701.2 Gene:Ir94c / 318727 FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:339 Identity:63/339 - (18%)
Similarity:104/339 - (30%) Gaps:101/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 KLIGCLLI--------------------AYAVFVLIETLILWLTH-RISGREVRLTSLNQLLNPR 346
            :::||||:                    ...||..:....|.|.| |.:|..:.|..       .
  Fly   310 RVVGCLLLNAHNLTSLEIWSFPFQALTWICLVFSFLSISCLALLHXRGAGDRLALVL-------A 367

  Fly   347 AFRGILGLPFPEFRRSSISLRQLFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSG 411
            .:...||||.....|.|:.|  ||....:|||:..:..|..|..:|..........|.::|....
  Fly   368 VYAASLGLPIDPPERPSLQL--LFASWLIFGLIVRSMYSALLFFILRYHLHQRLPGNLQDLTHGD 430

  Fly   412 LITIMDKYTHSFIEKHIDPEFFDHVLPHYLILQKKEALRMIWNFNDSYSYVMYTTTWKSLNTVQK 476
            ...:|.:.|                      ||.   ||.:.:..|.........|.:....|.:
  Fly   431 YAAVMGRTT----------------------LQD---LREVPSLQDLLGLKSVIVTSEREEEVLR 470

  Fly   477 SFDERVFCESES----------------LTIAWNLPRMYVLGNNSVLKWMLSRY----------- 514
            :.|.....|...                ||...:....|.:....||:..|:.|           
  Fly   471 TLDRCTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAYHIIPQDVLEQQLAIYLQKHSHLASHL 535

  Fly   515 ---ITYMPQTGIPDSWTEQLPKV----LKLLYNVTSPRRIKEGAVPLSIQHLSWIWHLLFIGESI 572
               :..:...|:...|..|:...    .:.||.   .:||::..:        |..::|..|..:
  Fly   536 DHLVMSIRSVGLVHHWAGQMASERYFRSRFLYR---EKRIRQPDL--------WAVYILTAGLYL 589

  Fly   573 ATL-VFIVEILLQK 585
            .:| |||.|:|..:
  Fly   590 LSLVVFICELLASR 603



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.