DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl1 and AT4G18950

DIOPT Version :10

Sequence 1:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_567568.1 Gene:AT4G18950 / 827630 AraportID:AT4G18950 Length:459 Species:Arabidopsis thaliana


Alignment Length:274 Identity:79/274 - (28%)
Similarity:138/274 - (50%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVKIFDFLEETIK-----KNAEREITHLSEIDH 63
            ::||.:.|...|       |....|.::..::|||..|  :|.:.     :....|:..|..:.|
plant   157 ELDFTQSKEITK-------GTYCMAMWRGIQVAVKKLD--DEVLSDDDQVRKFHDELALLQRLRH 212

  Fly    64 ENVIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALAYLHSL-DR 127
            .|:::.:|..:......::.|||..|.|...|  ..|.:.....|||:||..|:.::|||.: ..
plant   213 PNIVQFLGAVTQSNPMMIVTEYLPRGDLRELL--KRKGQLKPATAVRYALDIARGMSYLHEIKGD 275

  Fly   128 PIVHRDIKPQNMLLYNQHEDLKICDFGLA--TDMSNNK--TDMQGTLRYMAPEAIKHLKYTAKCD 188
            ||:|||::|.| :|.:....||:.|||::  ..:..:|  |....:.||:|||.....:|..|.|
plant   276 PIIHRDLEPSN-ILRDDSGHLKVADFGVSKLVTVKEDKPFTCQDISCRYIAPEVFTSEEYDTKAD 339

  Fly   189 VYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPM-EAVRSDCPEGIKQLMECCMDIN 252
            |:||.:::.|::..::|::..|:..:..|.     :|:..|: :|...:.|.|:|.|:|.|....
plant   340 VFSFALIVQEMIEGRMPFAEKEDSEASEAY-----AGKHRPLFKAPSKNYPHGLKTLIEECWHEK 399

  Fly   253 PEKRPSMKEIEKFL 266
            |.|||:.:||.|.|
plant   400 PAKRPTFREIIKRL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl1NP_732554.1 STKc_TAK1 17..274 CDD:270960 75/261 (29%)
AT4G18950NP_567568.1 ANKYR <42..>134 CDD:440430
ANK repeat 42..73 CDD:293786
ANK repeat 75..106 CDD:293786
ANK repeat 108..133 CDD:293786
STKc_MAP3K-like 176..413 CDD:270901 72/246 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.