DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl1 and ripk1

DIOPT Version :10

Sequence 1:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001072503.1 Gene:ripk1 / 779958 XenbaseID:XB-GENE-1012365 Length:669 Species:Xenopus tropicalis


Alignment Length:236 Identity:76/236 - (32%)
Similarity:123/236 - (52%) Gaps:37/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 EREITHLSEIDHENVIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCA 116
            |.:|.|:  :.::.|::::|.....:...|:|||:..|.|...|   .:.|..:....|:.|:..
 Frog    63 EGKIMHM--LKNDRVVKLLGLILENENYSLVMEYIRNGHLLTVL---QQVEVPLSVKTRFILEII 122

  Fly   117 KALAYLHSLDRPIVHRDIKPQNMLLYNQHED--LKICDFGLAT-----DMSNNKTDMQ------- 167
            :.::|||  |:.:||:|:||:|:|:   .||  :||.|.||||     .::..::.:|       
 Frog   123 EGMSYLH--DQKVVHKDLKPENILV---DEDFHIKIADLGLATFNRWSKLTKEQSKLQRKYMHQS 182

  Fly   168 --------GTLRYMAPEAIKHL--KYTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAI 222
                    |||.|||||.::.|  :.|.|.|||||||:.|.:.|.:.||   ||..:...|...:
 Frog   183 TGSYKSNAGTLIYMAPEHLRSLNARPTEKSDVYSFGIVTWVIFTNKEPY---ENALNDEQISYCV 244

  Fly   223 SSGEKLPMEAVRSDCPEGIKQLMECCMDINPEKRPSMKEIE 263
            ...|:..:|.:..:||.....||:.|.|.||:|||..||.:
 Frog   245 KKSERPCLEELPEECPPEALDLMQQCWDDNPDKRPLFKECD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl1NP_732554.1 STKc_TAK1 17..274 CDD:270960 76/236 (32%)
ripk1NP_001072503.1 Protein Kinases, catalytic domain 23..293 CDD:473864 76/236 (32%)
DD 576..660 CDD:472698
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.