DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Takl1 and Fgfr3

DIOPT Version :10

Sequence 1:NP_732554.1 Gene:Takl1 / 318725 FlyBaseID:FBgn0046689 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001156689.1 Gene:Fgfr3 / 14184 MGIID:95524 Length:802 Species:Mus musculus


Alignment Length:311 Identity:89/311 - (28%)
Similarity:150/311 - (48%) Gaps:58/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KFLGAGSGGAV---------RKATFQNQEIAVKIFDFLEETIKKNA-EREITHL-SEID------ 62
            |.||.|..|.|         :..|.:...:|||:       :|.:| :::::.| ||::      
Mouse   472 KPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKM-------LKDDATDKDLSDLVSEMEMMKMIG 529

  Fly    63 -HENVIRVIGRASNGKKDYLLMEYLEEGSLHNYL---------YGDD-----KWEYTVEQAVRWA 112
             |:|:|.::|..:.|...|:|:||..:|:|..:|         |..|     :.:.|.:..|..|
Mouse   530 KHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCA 594

  Fly   113 LQCAKALAYLHSLDRPIVHRDIKPQNMLLYNQHEDLKICDFGLATDMSN---NKTDMQGTL--RY 172
            .|.|:.:.||.|  :..:|||:..:|:|: .:...:||.|||||.|:.|   .|....|.|  ::
Mouse   595 YQVARGMEYLAS--QKCIHRDLAARNVLV-TEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW 656

  Fly   173 MAPEAIKHLKYTAKCDVYSFGIMLWELMT-RQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSD 236
            |||||:....||.:.||:|||::|||:.| ...||..:  |..:  :.|.:..|.::...|   .
Mouse   657 MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGI--PVEE--LFKLLKEGHRMDKPA---S 714

  Fly   237 CPEGIKQLMECCMDINPEKRPSMKEIEKFLGEQYE-SGTDE--DFIKPLDE 284
            |...:..:|..|....|.:||:.|::.:.|..... :.|||  |...|.::
Mouse   715 CTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQ 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Takl1NP_732554.1 STKc_TAK1 17..274 CDD:270960 83/295 (28%)
Fgfr3NP_001156689.1 ig 46..110 CDD:395002
Ig strand B 55..59 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..94 CDD:409353
Ig strand F 104..108 CDD:409353
IgI_2_FGFR 145..239 CDD:409443
Ig strand A 145..148 CDD:409443
Ig strand A' 156..161 CDD:409443
Ig strand B 165..173 CDD:409443
Ig strand C 179..184 CDD:409443
Ig strand C' 187..189 CDD:409443
Ig strand D 198..201 CDD:409443
Ig strand E 205..210 CDD:409443
Ig strand F 219..226 CDD:409443
Ig strand G 229..239 CDD:409443
IgI_3_FGFR 247..347 CDD:409363
Ig strand A 247..250 CDD:409363
Ig strand A' 254..258 CDD:409363
Ig strand B 266..273 CDD:409363
Ig strand C 277..284 CDD:409363
Ig strand D 299..304 CDD:409363
Ig strand E 315..320 CDD:409363
Ig strand F 328..336 CDD:409363
Ig strand G 339..347 CDD:409363
PTKc_FGFR3 455..788 CDD:173652 89/311 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.