DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and MKK10

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_174510.1 Gene:MKK10 / 840124 AraportID:AT1G32320 Length:305 Species:Arabidopsis thaliana


Alignment Length:290 Identity:94/290 - (32%)
Similarity:138/290 - (47%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 DLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIVGFYG 150
            |||||..||.|:||.|.|.||..|..:.|.|::    :|.:...:..|..:|.......|:..|.
plant    47 DLEKLSVLGQGSGGTVYKTRHRRTKTLYALKVL----RPNLNTTVTVEADILKRIESSFIIKCYA 107

  Fly   151 AFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAIIHRDVKPSNI 215
            .|.|..::...||.|:.|||...|.......|.::..:...:|:||.||: ...|:|.|:||||:
plant   108 VFVSLYDLCFVMELMEKGSLHDALLAQQVFSEPMVSSLANRILQGLRYLQ-KMGIVHGDIKPSNL 171

  Fly   216 LVNSSGEIKICDFGVSGQLIDSMANSFVGTRSYMSPERLQ------GTHYSVQSDIWSLGLSLVE 274
            |:|..||:||.|||.| :::........||.:||||||:.      |.......|:||||:.::|
plant   172 LINKKGEVKIADFGAS-RIVAGGDYGSNGTCAYMSPERVDLEKWGFGGEVGFAGDVWSLGVVVLE 235

  Fly   275 MAIGMYPI----PPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFST 335
            ..||.||:    ..|:.|||......|                 |.:|..|:          .|.
plant   236 CYIGRYPLTKVGDKPDWATLFCAICCN-----------------EKVDIPVS----------CSL 273

  Fly   336 EFKDFVDICLKKQPDERADLKTLLSHPWIR 365
            ||:|||..||:|...:|..::.||.|.:::
plant   274 EFRDFVGRCLEKDWRKRDTVEELLRHSFVK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 94/290 (32%)
S_TKc 88..364 CDD:214567 92/285 (32%)
MKK10NP_174510.1 PKc_like 46..305 CDD:419665 94/290 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.