DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and MKK7

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_173271.1 Gene:MKK7 / 838416 AraportID:AT1G18350 Length:307 Species:Arabidopsis thaliana


Alignment Length:300 Identity:114/300 - (38%)
Similarity:167/300 - (55%) Gaps:47/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFPHIV 146
            :|..|:|||..||.|:.|:|.||.|..|..|.|.|.::.::.||..:|:.||:::|...:.|::|
plant    40 ISASDVEKLHVLGRGSSGIVYKVHHKTTGEIYALKSVNGDMSPAFTRQLAREMEILRRTDSPYVV 104

  Fly   147 GFYGAFYSD--GEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHA--IIH 207
            ...|.|...  ||:||.|||||||:|:.:   .|.:.|..|...:..:|||||||   |:  |:|
plant   105 RCQGIFEKPIVGEVSILMEYMDGGNLESL---RGAVTEKQLAGFSRQILKGLSYL---HSLKIVH 163

  Fly   208 RDVKPSNILVNSSGEIKICDFGVSGQLIDSM--ANSFVGTRSYMSPERLQ---GTHYSVQS-DIW 266
            ||:||:|:|:||..|:||.|||||..:..|:  .||:|||.:||||||..   |.:..|.: |||
plant   164 RDIKPANLLLNSRNEVKIADFGVSKIITRSLDYCNSYVGTCAYMSPERFDSAAGENSDVYAGDIW 228

  Fly   267 SLGLSLVEMAIGMYPIPP----PNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPK 327
            |.|:.::|:.:|.:|:.|    |:.|||..:..     .|:|...|...                
plant   229 SFGVMILELFVGHFPLLPQGQRPDWATLMCVVC-----FGEPPRAPEGC---------------- 272

  Fly   328 LEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKA 367
                  |.||:.|||.||:|:..||.....||.||::|::
plant   273 ------SDEFRSFVDCCLRKESSERWTASQLLGHPFLRES 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 113/296 (38%)
S_TKc 88..364 CDD:214567 111/289 (38%)
MKK7NP_173271.1 PKc_MAPKK_plant_like 43..305 CDD:132954 112/294 (38%)
S_TKc 46..303 CDD:214567 111/289 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0581
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.