DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and MKK3

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001318713.1 Gene:MKK3 / 834042 AraportID:AT5G40440 Length:520 Species:Arabidopsis thaliana


Alignment Length:317 Identity:127/317 - (40%)
Similarity:177/317 - (55%) Gaps:49/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQILRELKVLHECNFP-H 144
            :.:..::...|.:|||...||.:..|...|.|:|.|.|::..:.. ::|:|.|::.|  |..| |
plant    77 QCASHEMRVFGAIGSGASSVVQRAIHIPNHRILALKKINIFEREK-RQQLLTEIRTL--CEAPCH 138

  Fly   145 --IVGFYGAFYS--DGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAI 205
              :|.|:|||||  .|:|||.:|||:||||..|||...:|||.:|..:...:|:|||||.....:
plant   139 EGLVDFHGAFYSPDSGQISIALEYMNGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHL 203

  Fly   206 IHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMA--NSFVGTRSYMSPERLQGTHYSVQSDIWSL 268
            :|||:||:|:|:|..||.||.|||:|..|.:|||  .:||||.:||||||::...||..:|||||
plant   204 VHRDIKPANLLINLKGEPKITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSL 268

  Fly   269 GLSLVEMAIGMYPI----PPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEP---PP 326
            ||:|.|...|.:|.    .|.|                             |:..|:::|   ||
plant   269 GLALFECGTGEFPYIANEGPVN-----------------------------LMLQILDDPSPTPP 304

  Fly   327 KLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAELEEVDISGWVCKTMD 383
            |.|   ||.||..|:|.||:|.||.|.....|||||:|.|.|.|.||::.:|....|
plant   305 KQE---FSPEFCSFIDACLQKDPDARPTADQLLSHPFITKHEKERVDLATFVQSIFD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 126/310 (41%)
S_TKc 88..364 CDD:214567 119/289 (41%)
MKK3NP_001318713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0581
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100914
Panther 1 1.100 - - LDO PTHR48013
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X438
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.