DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and Slik

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_726441.1 Gene:Slik / 37893 FlyBaseID:FBgn0035001 Length:1703 Species:Drosophila melanogaster


Alignment Length:386 Identity:110/386 - (28%)
Similarity:171/386 - (44%) Gaps:83/386 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAI 126
            |:.::||    |....|:.....|..|.:||||.|..|.|.|.:|.......|.|:..||.:..:
  Fly    16 GEAKKKR----LYNNIKMDTDPAEFWEMVGELGDGAFGKVYKAQHKEQKRFAAAKMCQLEDEENL 76

  Fly   127 KKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGR-IPESILGRITL 190
            ...:: |:.:|.|...|:||..|.||..|.::.:.:||.|||:||.|:....: :.|..:..:..
  Fly    77 SDHMV-EIDILSEIKHPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCK 140

  Fly   191 AVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMA--NSFVGTRSYMSP-- 251
            .:.:||::|..| .:||||:|..|:|:...|.:|:.|||||.:...:|.  ::|:||..:|:|  
  Fly   141 HMTEGLTFLHRN-KVIHRDLKAGNVLLTMEGGVKLADFGVSAKNKHTMQKHDTFIGTPYWMAPEL 204

  Fly   252 ---ERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAI 313
               |..:...|..:.||||||::|:|:|    .:.|||:                      .|:.
  Fly   205 VLCETFRDNPYDHKVDIWSLGITLIELA----QMEPPNS----------------------EMSP 243

  Fly   314 FELLDYIVNEPPPKLEH-KIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIR------------ 365
            ..:|..|....|||||. ..:|.||.||:...|.|.|..|.....|:.|.:|.            
  Fly   244 MRVLLKIQKSEPPKLEQPSRWSKEFNDFLKKSLVKDPQVRPTTDVLMQHAFINRNLDAKPIKDLL 308

  Fly   366 ---KAE-LEEV-------------------DISGWVCKTMDLPPSTP-------KRNTSPN 396
               ||| :|||                   |.:....:.:|..|.||       |..:.|:
  Fly   309 LEYKAEVVEEVVDDETEEPRNSALQLDLDDDSASLQSQDIDKLPGTPTSILRDAKEQSQPS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 99/340 (29%)
S_TKc 88..364 CDD:214567 90/284 (32%)
SlikNP_726441.1 STKc_SLK_like 31..310 CDD:132942 92/306 (30%)
S_TKc 37..295 CDD:214567 90/285 (32%)
PKK 958..1095 CDD:289257
PKK 1126..1266 CDD:289257
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.