DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and hppy

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_725863.1 Gene:hppy / 37203 FlyBaseID:FBgn0263395 Length:1218 Species:Drosophila melanogaster


Alignment Length:294 Identity:91/294 - (30%)
Similarity:157/294 - (53%) Gaps:46/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKKQIL-RELKVLHECNFPHIVGF 148
            ::.|.:.::|||..|.|.|.:...::.:.|.|:|.||  |:...||: :|:.::.:|..|:|:.:
  Fly    24 DEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLE--PSDDIQIIQQEIIMMRDCRHPNIIAY 86

  Fly   149 YGAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLKGLSYLRDNHAI--IHRDVK 211
            ||::....::.||||:..||||..|.:..|.:.|..:..:....||||.||   |::  :|||:|
  Fly    87 YGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQIAYMCRETLKGLEYL---HSMGKMHRDIK 148

  Fly   212 PSNILVNSSGEIKICDFGVSGQLIDSM--ANSFVGTRSYMSP-----ERLQGTHYSVQSDIWSLG 269
            .:|||:...|::|:.|||||.|:..::  ..||:||..:|:|     ||..|  |:...|||:.|
  Fly   149 GANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAVERKGG--YNQLCDIWACG 211

  Fly   270 LSLVEMAIGMYPIPPP--NTATLESIFADNAEESGQPTDEPRAMAIFELLDYIVNEPPPKLEHK- 331
            ::.:|:|    .:.||  :...:.::|.  ..:||           |:         ||.|.:| 
  Fly   212 ITAIELA----ELQPPMFDLHPMRALFL--MSKSG-----------FK---------PPTLNNKD 250

  Fly   332 IFSTEFKDFVDICLKKQPDERADLKTLLSHPWIR 365
            .:|..|.:|:...|.|.|.:|...:.||.||:::
  Fly   251 KWSPTFHNFIKTALTKNPKKRPTAERLLQHPFVQ 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 91/294 (31%)
S_TKc 88..364 CDD:214567 91/288 (32%)
hppyNP_725863.1 STKc_MAP4K3_like 25..283 CDD:270788 91/290 (31%)
S_TKc 26..283 CDD:214567 91/289 (31%)
CNH 869..1184 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.