DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and Tao

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001188672.1 Gene:Tao / 32948 FlyBaseID:FBgn0031030 Length:1039 Species:Drosophila melanogaster


Alignment Length:313 Identity:96/313 - (30%)
Similarity:145/313 - (46%) Gaps:51/313 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GELSDEDL-------------EKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAIKK--Q 129
            |.|.|.::             |.|.|:|.|:.|.|...|...|..|:|.|.:....|.:.:|  .
  Fly     7 GSLKDPEIADLFNKHDPEKIFEDLREIGHGSFGAVYYARCNLTREIVAIKKMSYTGKQSQEKWQD 71

  Fly   130 ILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRIPESILGRITLAVLK 194
            ||:|::.|.:.|.|:.:.:.|.:..:....:.|||..|.:.|:|......:.|..:..|.|.||.
  Fly    72 ILKEIRFLRQLNHPNTIEYKGCYLRESTAWLVMEYCVGSASDIIEVHKKPLHEDEIAAICLGVLS 136

  Fly   195 GLSYLRDNHAI--IHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMANSFVGTRSYMSPE---RL 254
            |||||   |::  ||||:|..|||:..:|.:|:.|||.:.  |...|||||||..:|:||   .:
  Fly   137 GLSYL---HSLGRIHRDIKAGNILLTDNGVVKLADFGSAA--IKCPANSFVGTPYWMAPEVILAM 196

  Fly   255 QGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAMAIFELLDY 319
            ....|..:.|:||||::.:|:|                       |...|.....||:   .|.:
  Fly   197 DEGQYDGKVDVWSLGITCIELA-----------------------ERKPPYFNMNAMS---ALYH 235

  Fly   320 IVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAELEEV 372
            |.....|.|....:|..|..||::||||.|.||.....||:|.::.:...:.|
  Fly   236 IAQNESPTLPKNDWSDAFCSFVELCLKKMPAERPSSAKLLTHAYVTRPRSDTV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 93/308 (30%)
S_TKc 88..364 CDD:214567 92/282 (33%)
TaoNP_001188672.1 STKc_TAO 25..282 CDD:270784 92/287 (32%)
S_TKc 27..280 CDD:214567 92/283 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.