DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dsor1 and Map2k3

DIOPT Version :9

Sequence 1:NP_511098.1 Gene:Dsor1 / 31872 FlyBaseID:FBgn0010269 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001094144.1 Gene:Map2k3 / 303200 RGDID:1306620 Length:347 Species:Rattus norvegicus


Alignment Length:392 Identity:133/392 - (33%)
Similarity:200/392 - (51%) Gaps:86/392 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKNKLNLVL-----PPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLDM 61
            ||.|.:|.:     |||:.          ||||                 .::|:.|        
  Rat    19 SKRKRDLRISCVSKPPVSN----------PTPP-----------------RNLDSRT-------- 48

  Fly    62 GDTERKRIKMFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHLEVKPAI 126
                      |::..::..|:..:||..:.|||.|..|||.||||..:..|||.|.|...|....
  Rat    49 ----------FITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQE 103

  Fly   127 KKQILRELKV-LHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLD----LILKRAGRIPESILG 186
            :|::|.:|.: :...:..:.|.||||.:.:|::.||||.|| .|||    .:|::..:|||.|||
  Rat   104 QKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMD-TSLDKFYRKVLEKNMKIPEDILG 167

  Fly   187 RITLAVLKGLSYLRDNHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMANSF-VGTRSYMS 250
            .|.:::::.|.:|....::|||||||||:|:|..|.:|:||||:||.|:||:|.:. .|.:.||:
  Rat   168 EIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMA 232

  Fly   251 PER----LQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEESGQPTDEPRAM 311
            |||    |....|:|:||:||||::::||||..:|.                |..|.|       
  Rat   233 PERINPELNQKGYNVKSDVWSLGITMIEMAILRFPY----------------ESWGTP------- 274

  Fly   312 AIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLSHPWIRKAELEEVDISG 376
              |:.|..:|.||.|:|....||.||.||...||:|.|.||.....|:.||:....:.::.||:.
  Rat   275 --FQQLKQVVEEPSPQLPADQFSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAA 337

  Fly   377 WV 378
            :|
  Rat   338 FV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dsor1NP_511098.1 PKc_MEK 85..382 CDD:132946 118/304 (39%)
S_TKc 88..364 CDD:214567 113/285 (40%)
Map2k3NP_001094144.1 PKc_MKK3_6 62..344 CDD:173729 118/304 (39%)
S_TKc 67..325 CDD:214567 113/283 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D688282at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.