DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31407 and CG5968

DIOPT Version :9

Sequence 1:NP_001287265.1 Gene:CG31407 / 318716 FlyBaseID:FBgn0051407 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001260505.1 Gene:CG5968 / 34986 FlyBaseID:FBgn0032588 Length:159 Species:Drosophila melanogaster


Alignment Length:100 Identity:30/100 - (30%)
Similarity:47/100 - (47%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 NGALVLEVLKVLGRPATSYEVAERVADVYRLPLHRIRPVVTDVLEAGSRHGFFSSLNGHYSVVQP 74
            |||:::..|::|..|||..|:...:|....|....::..|...||.|.|.||...|:|.|.::..
  Fly     5 NGAIIVHTLQLLKAPATLREIVVTIAKNTELSQDELKEPVKQTLEMGHRLGFLQKLDGRYFLMNV 69

  Fly    75 VVEQLGRDIDQYAADILAGYSCEGSLPKMSTLMLK 109
            ..|.|..:::....:    .|.|.||.|...|:.|
  Fly    70 TFETLMSEMEALDKE----ESPEKSLKKKKKLIPK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31407NP_001287265.1 DUF4777 6..71 CDD:292626 21/60 (35%)
CG5968NP_001260505.1 DUF4777 1..66 CDD:292626 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444780
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.