DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZSCAN12

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001156863.1 Gene:ZSCAN12 / 9753 HGNCID:13172 Length:611 Species:Homo sapiens


Alignment Length:351 Identity:94/351 - (26%)
Similarity:147/351 - (41%) Gaps:74/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKCPRC-----------------------NCDATGQNRLVTDSCGHTK-CRLCLVADVSDCLEC 41
            |:|..||                       .||..|.:  :|::..||: .|:|...:...|.:|
Human   217 MSKSARCGETREPEEITEEPSACSREDKQPTCDENGVS--LTENSDHTEHQRICPGEESYGCDDC 279

  Fly    42 RVARSVDIQETQETQARTSADKRIIVTDKGYHCTVCNKDFRSRT--------------------- 85
            ..|.|        ..:.....:||...|:.|.|..|.|.||.||                     
Human   280 GKAFS--------QHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECG 336

  Fly    86 ---------QQYYHLTCGNDLLKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQP 141
                     .|:..|..|.   |.::|.:||:.|:..:.|.:|:..|.:...:.|:.|:|||.:.
Human   337 KAFGRWSALNQHQRLHTGE---KHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRR 398

  Fly   142 IVLQRHMLTHNQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLR 205
            .:|.:|...|...| :.|..|.|.|...|||.||..||..... ::|:.|.|.| :::.|.||.|
Human   399 SILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKC-YQCKECGKSF-SQSGLIQHQR 461

  Fly   206 KHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAER- 269
            .|.... .:.|.||:|:|:::|:|..|.:.|:......|..|||::.....|..|.|.| |.|| 
Human   462 IHTGEK-PYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQRSVLTEHQRIH-TGERP 524

  Fly   270 YRCIQCDITINRKDNMLRHLRSMHPG 295
            |:|.:|........::::|.| :|.|
Human   525 YKCDECGNAFRGITSLIQHQR-IHTG 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 9/49 (18%)
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
COG5048 <112..288 CDD:227381 55/177 (31%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 35/103 (34%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368 8/19 (42%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368 3/17 (18%)
ZSCAN12NP_001156863.1 SCAN 42..152 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..175
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..264 10/48 (21%)
C2H2 Zn finger 248..268 CDD:275368 7/21 (33%)
C2H2 Zn finger 276..296 CDD:275368 5/27 (19%)
COG5048 299..579 CDD:227381 76/259 (29%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 332..352 CDD:275368 1/19 (5%)
C2H2 Zn finger 360..380 CDD:275368 6/19 (32%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 416..436 CDD:275368 9/19 (47%)
C2H2 Zn finger 444..463 CDD:275368 8/19 (42%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 527..547 CDD:275368 4/20 (20%)
C2H2 Zn finger 555..575 CDD:275368
C2H2 Zn finger 583..603 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.