DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and PGBD1

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001171672.1 Gene:PGBD1 / 84547 HGNCID:19398 Length:809 Species:Homo sapiens


Alignment Length:324 Identity:62/324 - (19%)
Similarity:102/324 - (31%) Gaps:121/324 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 AIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDK-NNIRHMCKVCQKSFLRQTTLRLHMKRHSNR 239
            ||..|   :|:....:.||.:    |.||.:.|| ..:|.:.|...|:||    |...::.:...
Human   492 AIRRD---RFELIFSNLHFAD----NGHLDQKDKFTKLRPLIKQMNKNFL----LYAPLEEYYCF 545

  Fly   240 ERQSCSL-------------------CG-------------------KSYNDPD-ALGRHLRQHK 265
            ::..|..                   ||                   |...||| .||.:|    
Human   546 DKSMCECFDSDQFLNGKPIRIGYKIWCGTTTQGYLVWFEPYQEESTMKVDEDPDLGLGGNL---- 606

  Fly   266 TAERYRCIQCDITINRKDNMLRHLRSMHPG--C--AFASTVEMVTPRSSAQEATTAEERPSQTVR 326
                        .:|..|.:|.  |..:|.  |  :|.::|::::.........|...|.::|  
Human   607 ------------VMNFADVLLE--RGQYPYHLCFDSFFTSVKLLSALKKKGVRATGTIRENRT-- 655

  Fly   327 YNSVIQSVGNVEPVMLLQSTPLPSQLPELQMEKGKAVPEHLPLPDVMPEENVQL-----YRKIIL 386
                             :..||.:.....:|::|..        |...|||.::     |...|:
Human   656 -----------------EKCPLMNVEHMKKMKRGYF--------DFRIEENNEIILCRWYGDGII 695

  Fly   387 DLDNEEYSSEPSPDA------QEPAMQHHQPRVP------GQGSSK----FSEMHWRKNFKYWY 434
            .|.:.....||..:.      .|...|..||.:.      .:|.:|    .|:...|...|.||
Human   696 SLCSNAVGIEPVNEVSCCDADNEEIPQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWY 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
COG5048 <112..288 CDD:227381 30/151 (20%)
C2H2 Zn finger 131..151 CDD:275368
Chordopox_A33R 151..>254 CDD:283591 21/116 (18%)
C2H2 Zn finger 158..178 CDD:275368 1/1 (100%)
C2H2 Zn finger 187..207 CDD:275368 5/19 (26%)
C2H2 Zn finger 216..236 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 10/58 (17%)
C2H2 Zn finger 272..290 CDD:275368 3/17 (18%)
PGBD1NP_001171672.1 SCAN 40..142 CDD:128708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..297
DDE_Tnp_1_7 418..775 CDD:372752 62/324 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.