DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZSCAN5A

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001308993.1 Gene:ZSCAN5A / 79149 HGNCID:23710 Length:496 Species:Homo sapiens


Alignment Length:146 Identity:52/146 - (35%)
Similarity:70/146 - (47%) Gaps:3/146 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPIC 161
            |..|.|..|.:||..:|.|..|..||..:....|::|.|.|.|.|.||.|..||..|: :.|.:|
Human   353 LPPFACDVCEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVC 417

  Fly   162 QKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQ 226
            ||.|.:||.|..|...|:. ...|:|:.|.|.|..:.:|.:|.|.|.... .:.|..|.::|.|.
Human   418 QKQFTQKSYLKCHKRSHTG-EKPFECKDCKKVFTYRGSLKEHQRIHSGEK-PYKCSKCPRAFSRL 480

  Fly   227 TTLRLHMKRHSNRERQ 242
            ..||.|.|.|.....|
Human   481 KLLRRHQKTHPEATSQ 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
COG5048 <112..288 CDD:227381 46/132 (35%)
C2H2 Zn finger 131..151 CDD:275368 9/19 (47%)
Chordopox_A33R 151..>254 CDD:283591 31/93 (33%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 8/19 (42%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
ZSCAN5ANP_001308993.1 SCAN 40..124 CDD:153421
2a38euk <117..>328 CDD:130009
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..183
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..348
COG5048 <339..492 CDD:227381 51/140 (36%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
zf-H2C2_2 398..423 CDD:404364 11/24 (46%)
C2H2 Zn finger 414..434 CDD:275368 9/19 (47%)
zf-H2C2_2 430..451 CDD:404364 7/21 (33%)
C2H2 Zn finger 442..462 CDD:275368 7/19 (37%)
zf-H2C2_2 454..479 CDD:404364 7/25 (28%)
C2H2 Zn finger 470..490 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.