DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42726 and ZNF232

DIOPT Version :9

Sequence 1:	NP_732017.3	Gene:	CG42726 / 318709	FlyBaseID:	FBgn0261679	Length:	441	Species:	Drosophila melanogaster
Sequence 2:	NP_055334.2	Gene:	ZNF232 / 7775	HGNCID:	13026	Length:	444	Species:	Homo sapiens

Alignment Length:	190	Identity:	56/190 - (29%)
Similarity:	75/190 - (39%)	Gaps:	32/190 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    79 KDFRSRTQQYYHLTCGNDLLKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIV 143
            :.||.....:..:..|.   |...|.|||:.|..:|||..|...|..:..:.||.|.|:|||...
Human   284 ESFRQMVVIHKEIPTGK---KDHECSECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSN 345

  Fly   144 LQRHMLTHNQEKHLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHD 208
            |.:|...|..||                            .|:|..|.|.|:..|:|.||.|.|.
Human   346 LGQHQRIHTGEK----------------------------PFECNECGKAFRWGAHLVQHQRIHS 382

  Fly   209 KNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAE 268
            ... .:.|..|.|:|.:.:.|..|.:.||..:...|..|||:|.....|.||.|.|...|
Human   383 GEK-PYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKE 441

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42726	NP_732017.3	C2H2 Zn finger	74..94	CDD:275368	2/14 (14%)
		C2H2 Zn finger	103..123	CDD:275368	9/19 (47%)
		COG5048	<112..288	CDD:227381	47/157 (30%)
		C2H2 Zn finger	131..151	CDD:275368	9/19 (47%)
		Chordopox_A33R	151..>254	CDD:283591	27/102 (26%)
		C2H2 Zn finger	158..178	CDD:275368	0/19 (0%)
		C2H2 Zn finger	187..207	CDD:275368	9/19 (47%)
		C2H2 Zn finger	216..236	CDD:275368	6/19 (32%)
		C2H2 Zn finger	244..264	CDD:275368	9/19 (47%)
		C2H2 Zn finger	272..290	CDD:275368
ZNF232	NP_055334.2	SCAN	75..188	CDD:128708
		SCAN	75..162	CDD:280241
		COG5048	<303..409	CDD:227381	39/134 (29%)
		zf-C2H2	303..325	CDD:278523	9/21 (43%)
		C2H2 Zn finger	305..325	CDD:275368	9/19 (47%)
		zf-H2C2_2	317..342	CDD:290200	9/24 (38%)
		C2H2 Zn finger	333..353	CDD:275368	9/19 (47%)
		zf-H2C2_2	345..368	CDD:290200	9/50 (18%)
		C2H2 Zn finger	361..381	CDD:275368	9/19 (47%)
		zf-H2C2_2	373..398	CDD:290200	9/25 (36%)
		COG5048	385..>437	CDD:227381	17/52 (33%)
		C2H2 Zn finger	389..409	CDD:275368	6/19 (32%)
		zf-H2C2_2	401..424	CDD:290200	8/22 (36%)
		C2H2 Zn finger	417..437	CDD:275368	9/19 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100