DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF215

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001341782.1 Gene:ZNF215 / 7762 HGNCID:13007 Length:517 Species:Homo sapiens


Alignment Length:208 Identity:52/208 - (25%)
Similarity:83/208 - (39%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KFNCKECGRRFATSSHLKY-------------HLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTH 151
            |||....|::     |.:|             |..||...:.:.|..|.|:|.:...|.||.:.|
Human   342 KFNLDSVGKQ-----HSEYEYGNDLSLSTDIRHQKSHTTMNSYECYQCGKAFCRSSSLIRHQIIH 401

  Fly   152 NQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHM 215
            ..|| :.|..|.:.|.|:::|..|..:|::      .:.|:.:...||    ..:..|.||    
Human   402 TGEKPYKCSECGRFFNRRTNLTKHQKLHAE------AKACTSNKCGKA----FSKSEDSNN---- 452

  Fly   216 CKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITIN 280
                       .||      |.......|..||||:|...:|.||...|...:.::|.:|....|
Human   453 -----------PTL------HFGNNFYQCVNCGKSFNRSSSLIRHQMIHTGEKPFKCKECSKAFN 500

  Fly   281 RKDNMLRHLRSMH 293
            |..|:::| :.:|
Human   501 RSSNLVKH-QKLH 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 4/32 (13%)
COG5048 <112..288 CDD:227381 46/189 (24%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 25/103 (24%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 187..207 CDD:275368 3/19 (16%)
C2H2 Zn finger 216..236 CDD:275368 2/19 (11%)
C2H2 Zn finger 244..264 CDD:275368 9/19 (47%)
C2H2 Zn finger 272..290 CDD:275368 6/17 (35%)
ZNF215NP_001341782.1 SCAN 44..132 CDD:307924
KRAB 164..226 CDD:214630
zf-C2H2 379..401 CDD:306579 7/21 (33%)
C2H2 Zn finger 381..401 CDD:275368 7/19 (37%)
zf-H2C2_2 393..418 CDD:316026 9/24 (38%)
C2H2 Zn finger 409..484 CDD:275368 25/105 (24%)
C2H2 Zn finger 412..429 CDD:275368 5/16 (31%)
COG5048 436..>517 CDD:227381 25/103 (24%)
C2H2 Zn finger 492..512 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.