DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF174

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001334797.1 Gene:ZNF174 / 7727 HGNCID:12963 Length:407 Species:Homo sapiens


Alignment Length:157 Identity:45/157 - (28%)
Similarity:68/157 - (43%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 MSHEKQSKHSCSVCHKSFKQPIV-LQRH----MLTHNQEKHLCPICQKVFRRKSSLASHLAIHSD 180
            ||..:.|:.  .|...:.::|.. .|||    .::...:.|.....:|....|.||::.|   ..
Human   254 MSEPRLSRR--QVSSPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKSKGGKRSLSNRL---QH 313

  Fly   181 LGLQ--------FKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHS 237
            ||.|        :||:.|.|.|...:.|.:|.|.|.... .:.|..|...|.||:||:||.:.|:
Human   314 LGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGER-PYTCGECGNCFGRQSTLKLHQRIHT 377

  Fly   238 NRERQSCSLCGKSYNDPDALGRHLRQH 264
            ..:...|..||||:.....|.:|.|.|
Human   378 GEKPYQCGQCGKSFRQSSNLHQHHRLH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 1/1 (100%)
COG5048 <112..288 CDD:227381 45/157 (29%)
C2H2 Zn finger 131..151 CDD:275368 5/24 (21%)
Chordopox_A33R 151..>254 CDD:283591 33/110 (30%)
C2H2 Zn finger 158..178 CDD:275368 5/19 (26%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 9/19 (47%)
C2H2 Zn finger 244..264 CDD:275368 8/19 (42%)
C2H2 Zn finger 272..290 CDD:275368
ZNF174NP_001334797.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..270 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.