DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and ZNF18

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001290210.1 Gene:ZNF18 / 7566 HGNCID:12969 Length:549 Species:Homo sapiens


Alignment Length:162 Identity:44/162 - (27%)
Similarity:74/162 - (45%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 CKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHLCPICQKVFRR 167
            |:|||:.|..:|.|.:|..:|..::...|::|.|:|.:.....:|..||..||.    |      
Human   410 CRECGKTFYRNSQLIFHQRTHTGETYFQCTICKKAFLRSSDFVKHQRTHTGEKP----C------ 464

  Fly   168 KSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLH 232
                              ||:.|.|.|.:.:.|..|.:.|.... .:.|.:|:|||::::....|
Human   465 ------------------KCDYCGKGFSDFSGLRHHEKIHTGEK-PYKCPICEKSFIQRSNFNRH 510

  Fly   233 MKRHSNRERQSCSLCGKSYNDPDALGRHLRQH 264
            .:.|:..:...||.||||::...:|.:|.|.|
Human   511 QRVHTGEKPYKCSHCGKSFSWSSSLDKHQRSH 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 39/153 (25%)
C2H2 Zn finger 131..151 CDD:275368 5/19 (26%)
Chordopox_A33R 151..>254 CDD:283591 25/102 (25%)
C2H2 Zn finger 158..178 CDD:275368 1/19 (5%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 9/19 (47%)
C2H2 Zn finger 272..290 CDD:275368
ZNF18NP_001290210.1 SCAN 37..148 CDD:322011
KRAB <222..249 CDD:307490
C2H2 Zn finger 410..430 CDD:275368 8/19 (42%)
COG5048 <436..549 CDD:227381 35/136 (26%)
C2H2 Zn finger 438..458 CDD:275368 5/19 (26%)
C2H2 Zn finger 466..486 CDD:275368 6/19 (32%)
zf-H2C2_2 479..503 CDD:316026 8/24 (33%)
C2H2 Zn finger 494..514 CDD:275368 6/19 (32%)
zf-H2C2_2 506..530 CDD:316026 8/23 (35%)
C2H2 Zn finger 522..542 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.