DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42726 and Zfp444

DIOPT Version :9

Sequence 1:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001139496.1 Gene:Zfp444 / 72667 MGIID:1923365 Length:331 Species:Mus musculus


Alignment Length:139 Identity:45/139 - (32%)
Similarity:55/139 - (39%) Gaps:19/139 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SCSVCHKSFKQPIVLQRHMLTHNQEK-HLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELCSKH 193
            ||..|.||..:|..|.||..:|:.|| |.||.|.|.||||..|..|...|               
Mouse   187 SCPECGKSPLKPAHLLRHRQSHSGEKPHACPECGKAFRRKEHLRRHRGTH--------------- 236

  Fly   194 FQNKANLNQHLRKHDKNNIRHMCKVCQKSFLRQTTLRLHMKRHSNRERQSCSLCGKSYNDPDALG 258
               ..:....||........|.|..|.|:|..:..|..|.|.||.....:|..|||.:...:.:.
Mouse   237 ---PGSPGPALRPLPAREKPHACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVL 298

  Fly   259 RHLRQHKTA 267
            ||.|.|..|
Mouse   299 RHQRIHGRA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368
COG5048 <112..288 CDD:227381 45/139 (32%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 31/103 (30%)
C2H2 Zn finger 158..178 CDD:275368 10/19 (53%)
C2H2 Zn finger 187..207 CDD:275368 2/19 (11%)
C2H2 Zn finger 216..236 CDD:275368 7/19 (37%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..290 CDD:275368
Zfp444NP_001139496.1 SCAN 26..103 CDD:366881
COG5048 <186..>284 CDD:227381 36/114 (32%)
C2H2 Zn finger 188..208 CDD:275368 8/19 (42%)
C2H2 Zn finger 216..236 CDD:275368 10/19 (53%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 282..304 CDD:333835 7/21 (33%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.